구강편평세포암종의발생단계에따른 TGFβ1 type Ⅱ 수용체의유전자변이 연세대학교대학원 치의학과 이은하

Save this PDF as:
 WORD  PNG  TXT  JPG

Size: px
Start display at page:

Download "구강편평세포암종의발생단계에따른 TGFβ1 type Ⅱ 수용체의유전자변이 연세대학교대학원 치의학과 이은하"

Transcription

1 구강편평세포암종의발생단계에따른 TGFβ1 type Ⅱ 수용체의유전자변이 연세대학교대학원 치의학과 이은하

2 구강편평세포암종의발생단계에따른 TGFβ1 type Ⅱ 수용체의유전자변이 지도김진교수 이논문을박사학위논문으로제출함 2004 년 12 월일 연세대학교대학원 치의학과 이은하

3 이은하의치의학박사학위논문을인준함 심사위원심사위원심사위원심사위원심사위원 인인인인인 연세대학교대학원 2004 년 12 월일

4 감사의글 끝나지않을것같기만하던박사과정이어느덧끝나게되었습니다. 이제또다른시작을위해무엇인가를준비해야할것만같습니다. 이논문이완성될때까지지도해주시고이끌어주신김진교수님께감사드립니다. 세월이흘러도늘열심히살아가시는교수님께항상부끄럽지않은제자가되도록노력하겠습니다. 바쁘신일정접어두시고조언아끼지않으신육종인교수님께도감사드리고, 멀리서도논문꼼꼼히보시고수정해주신윤정훈교수님께도감사드립니다. 환자들때문에힘드신와중에도논문에관심가져주신차인호교수님께깊이감사드립니다. 제가모르는것물어보며귀찮게해도잘가르쳐주시고설명해주신이은주교수님, 정말감사드립니다. 실험에대해아무것도모르던저에게실험하는방법차근차근설명해주고문제 가생길때마다이런저런조언해준김은정선생님무지무지고마워요. 그리고구 강병리학교실모든선생님들항상따뜻하게대해주셔서감사드립니다. 실험할때, 공부할때, 힘들때항상옆에있어준나의가장친한친구이자사랑 하는남편에게무척이나고맙습니다. 끝으로실험한다고, 논문쓴다고많이놀아주지도못했는데늦은밤학교까지데리 러오고, 발표연습하라고도와준사랑하는나의아들제원아너무너무고맙고대 견스럽다. 엄마늘너에게열심히살아가는모습보여줄게 년 12 월 이은하

5 목 차 Tables & Figures 국문요약 Ⅰ. 서론 1 Ⅱ. 연구재료및방법 5 가. 연구재료 5 나. 연구방법 6 ⑴ Laser capture microdissection(lcm) 을이용한세포분리 6 ⑵ DNA 추출 7 ⑶ TβRⅡ 중합효소반응 7 ⑷ 염기서열분석 9 ⑸ TβRⅡ 돌연변이에대한단백질구조분석 9 Ⅲ. 연구결과 11 ⑴ 다단계구강암발암과정에서 TβRⅡ 돌연변이분석 1 ⑵ TβRⅡ 돌연변이에대한단백질구조분석 15 Ⅳ. 총괄및고찰 20 Ⅴ. 결론 26 참고문헌 27 영문요약 37 - i -

6 Tables and Figures Table 1. Clinical and pathologic characteristics of the samples 5 Table 2. Primer sequences for TβRⅡ PCR 8 Table 3. TβRⅡ mutations in oral squamous cell carcinomas 13 Table 4. Amino acid changes in TβRⅡ mutation 15 Table 5. Incidence of missense mutations in multistep process 15 Figure 1 Histology of the microdissected samples 6 Figure 2 The structure of TβRⅡ gene 16 Figure 3 Sequence alignment of the extracellular domains(ecd) from TβRⅡ species homologues 17 Figure 4 The structure of TβRⅡ: Normal TβRⅡ frame 18 Figure 5 The structure of TβRⅡ: codon 135 missense mutation 19 - ii -

7 국문요약 구강편평세포암종의발생단계에따른 TGFβ1 type Ⅱ 수용체의유전자변이 Transforming growth factor β(tgfβ) 와그수용체는세포의성장, 분화를조절하고 apoptosis와 motility를조절하며결합조직의 remodeling을유도하는등다양한세포에서여러역할을하고있다. 특히 TGFβ는상피세포증식의강력한억제인자중의하나이다. 대부분의악성종양이세포증식을조절하는기능이소실되어발생하기때문에암발생단계의특정시기에서 TGFβ의기능이억제되거나신호전달기능이소실되었을것으로생각된다. 따라서두경부암발생과정의어느단계에 TGFβ type Ⅱ 수용체 (TβRⅡ) 유전자의변화가일어나는지, 나타난변화가암발생과정에어떤역할을하는지규명하기위해서는각단계의세포를따로구분하여연구를진행시켜야할필요가있다. 이에저자는 18예의구강편평세포암종조직에서레이저를이용하여외과적절제의경계부위인정상, 이형성, 침윤성암종, 경부림파절전이부위세포를각각분리하여 DNA를추출하고수용체유전인자의 exon 1~7에대해중합효소반응과염기서열분석을통해 TβRⅡ 돌연변이를조사하였고, 이런돌연변이가단백질의삼차원적구조변화를일으켰는지를분석하여다음과같은결과를얻었다 예중 6예의세포학적이형성부위에서여섯유형의유전자돌연변이가관찰되었다. 이중 1예는 exon 3의 codon 135 부위에서 ATG(Met) ACG(Thr) 으로바뀐 missense mutation이었고이부위의단백질삼차원구조변화분석결과단백질의구조가변화한것을관찰하였다. 3예는 exon 4에서세유형의 missense - iii -

8 mutation 이었고이중한유형은아미노산의 hydrophobicity 가변화되었다. 나머지 2 예는 exon 5 와 exon 7 에서 silent mutation 이었다 예의구강편평세포암종중 3 예의침윤성암종부위에서세유형의돌연변이 가관찰되었다. 3 예모두 exon 4 에서관찰되었고, codon 170, codon 186, codon 205 에서 missense mutation 이었다. 3. 경부림프절전이를나타냈던 9예의편평세포암종중 3예의침윤성암종부위에서여섯유형의돌연변이가관찰되었다. 모두 exon 4에존재하는돌연변이었고, codon 170, codon 221, codon 227, codon 236, codon 238에서 missense mutation 이, codon 389에서 silent mutation이관찰되었다. 4. 구강편평세포암종 18 예중 8 예에서 exon 4 의 codon 191 에 single nucleotide polymorphism(snp) 이관찰되었다. 이상의연구결과 TβRⅡ의돌연변이는암발생과정중전암단계부터일어난것을알수있었고, 돌연변이에의해단백질의구조가변화되면서 TGFβ와의결합친화력을감소시켜세포증식을억제하지못하는결과를초래하여발암작용을촉진한것으로생각하였다. 또한 exon 4에서 44% 의높은빈도로 SNP가관찰되어이는 cancer susceptibility 증가와관련이있을것으로사료된다. 핵심되는말 : TGFβ typeⅡ 수용체, 돌연변이, 단백질구조, 편평세포암종, 다단계 암발생과정 - iv -

9 구강편평세포암종의발생단계에따른 TGFβ1 type Ⅱ 수용체의유전적변이 ( 지도김진교수 ) 연세대학교대학원치의학과 이은하 Ⅰ. 서론 악성종양은다양한원인에의해발생되며그기전의하나가암유발유전자의활성과함께암억제유전자의비활성이다 (Kelly등 1999). Transforming growth factor β(tgfβ) 는상피세포증식의강력한억제인자중의하나로 (Chu등 1999; de Castecker등 2000; Kelly등 1999) 대부분의악성종양이세포증식을조절하는기능이상실되어발생하고있기때문에암발생단계의특정시기에 TGFβ의기능이억제되거나신호전달기능의상실이일어났을것으로생각되고있다. TGFβ는 135개의아미노산으로구성된 2개의동일한사슬로이루어져있고포유류에서는 TGFβ1, TGFβ2, TGFβ3, 3가지형태가존재하며이들각각은다른유전자에서 encode되나신호전달체계는모두같은수용체를통하여이루어진다 (Chih hu등 1998; de Caestecjer등 2000). TGFβ1은가장흔히종양세포에서증가되며종양형성과정에서가장많이연구되고있다. TGFβ 신호체계는특정세포 표면수용체에의해매개된다. 따라서이 논문에서는 TGFβ 수용체에초점을맞 추어연구하고자하였다

10 TGFβ의수용체에는 typeⅠ, Ⅱ, Ⅲ(betaglycan), Ⅳ, Ⅴ등이있다. TypeⅠ, Ⅱ, Ⅲ, Ⅴ 수용체는대부분의세포에서동시에발현되며 typeⅣ는단지뇌하수체세포에서만보인다. TypeⅡ 수용체 (TβRⅡ) 는 serine/threonine kinase를갖는 75-85kDa 의막단백질로 TGFβ와직접결합하며스스로인산화된다. TypeⅠ수용체 (TβRⅠ) 는 50-60kDa로기질과직접결합하지못한다 (Wrana등 1992; Wrana등 1994; Massague등 1992). TGFβ의생물학적인효과들은일차적으로 serine/threonine kinase receptors인 TβRⅠ과 TβRⅡ의상호작용에의해일어난다. 먼저 TβRⅡ가특이기질들과결합하게되면 TβRⅠ과수용체복합체를형성하게되고 TβRⅠ이후에 Smad 단백과함께세포내로신호가전달되게되고핵안의 Smad 복합체는 DNA에결합하여특정유전자의전사를돕는다. 이러한이유로 TβRⅠ과 TβRⅡ의기능이 TGFβ 신호전달체계에있어가장중요한요인이라할수있다 (Shi등 2003; Chen등 1995; Derynck등 1986; alexandrow등 1995; Kondo등 2003). 최근많은연구에의해 TβRⅡ 유전자가암억제유전자로알려지고있다. 두경부편평세포암종을포함한여러암세포주에서 TGFβ에의한성장억제효과가감소되고 (Roberts등 1990; Fynan등 1993; Reiss등 1990), TβRⅡ 유전자변이와발현변화가 TGFβ registance와암발생에연관이있으며 (Park등 1994; Lu등 1995; Parsons등 1995; Myeroff등 1995; Markowitz등 1995; Williams등 1996) 유방암과대장암세포에서정상의 TβRⅡ cdna가암발생을감소시킨다 (Sun등 1994; Wang 등 1995). 또한두경부암, 유방암, 폐암의 30-50% 에서염색체 3p22에위치한 TβR Ⅱ 유전자소실이있다.(Mathew등 1994; Maestro등 1993). 반복서열중하나의 adenine이 insertion 또는 deletion됨으로써결국 truncated receptor 단백질합성을나타낸다. 이러한 TβRⅡ 유전자돌연변이연구는지금까지 sporadic 대장암, 위암, 난소암등다양한인체암에서발견되었다 (Grady등 1998; Shin등 2000; Sæterdal등 2001; Parsons등 1995; Lucke등 2001). 또한 genomic instability를보이는종양세포에서이수용체의돌연변이가많이존재한다 (Orimo등 1998). 난소암에서높은 수의 TβRⅠ 돌연변이가관찰되었고 (Chen 등 2001), 두경부편평세포암종에서는 TβRⅡ 단백질의발현과연관된연구보고가있고 (Muro-Cacho 등 2001; Muro - 2 -

11 -Cacho 등 1999; Paterson 등 2001) 유전자돌연변이에대한연구는 TβRⅡ 의 missense mutation(garrigue-antar 등 1995) 과 TβRⅡ gene promotor 에서의돌연 변이를조사한연구 (Seijo 등 2001) 가있다. 한편, TGFβ와그수용체는암발생과정에복합적인역할을하는것으로알려져있다. 암발생초기단계에는암억제인자로역할을하며좀더진행된단계에서는오히려암유발인자로작용한다. 이의실험적근거들로는 TGFβ 신호체계가활성화되면원발성유선암의발생이지연되고 TGFβ 신호체계에이상이있었던쥐에서는좀더이른시기에종양이형성되어암발생초기단계에는 TGFβ가암억제인자로작용한다고하였고 (Siegel등 2000), 이와는반대로쥐에서의 spontaneous lung metastasis 형성실험에서는 TGFβ 수용체활성이증가된쥐에서전이암이훨씬많은빈도로나타나암의후반기에는 TGFβ가암유발인자로작용하는것으로생각할수있다 (Sporn등 1990). 또한유방암실험에서 TGFβ를첨가한세포주는전이가활발히일어나는 (Welch등 1990) 반면 TGFβ 수용체기능을억제시킨군에서는전이능력이급격히감소하는것을관찰할수있었다 (McEarchern등 2001). In vitro에서암발생초기에나타나는 TGFβ의암억제효과는 c-myc의발현을억제 시켜 cyclin-dependent kinase inhibitor 인 p15 와 p21 의발현을유도함으로써생 기는것으로생각되고 (Chen등 2001), 유방암이나전립선암이골조직과같은특정장기로전이되는데있어서 TGFβ의역할은 TGFβ/Smad와 p38이 osteolytic factor 인 PTHrP의발현을유도함으로써암전이를증진시킨다고한다 (Kakonen등 2002; Yin등 1999). 암억제유전자로서의 TGFβ에대한연구가많이진행되고있지만아직까지는두경부구강편평세포암종과 TGFβ의연관성연구는미흡한실정이고대부분의연구는세포배양으로얻어진암세포와정상세포, 동결조직에서얻은암조직과정상조직을이용함으로써단순히정상세포와암세포사이의차이가존재하는지에대한연구에국한되어있다

12 TGFβ의기능은다양하며, 암발생과정에서의그기능이암발생의초기단계와후기단계에서역시다르다고알려져있다. 이런연구들역시주로유방암이나전립선암등에서이루어졌고두경부암에서의연구는미흡하다. 따라서두경부암의발생단계에따른 TβRⅡ의역할을규명하기위해서는각단계의세포를따로따로분리하여연구를진행시켜야할필요가있다. 이에저자는구강편평세포암종의각단계에해당하는세포를레이저를이용하여따로따로분리하여분리된세포에서 TβRⅡ 돌연변이를조사하여그돌연변이의양상및시기를알아보고, 이런돌연변이가단백질의구조변화를유도하는지를연구함으로써구강편평세포암종발생과정에서 TβRⅡ의역할을규명하고자하였다

13 Ⅱ. 연구재료및방법 가. 연구재료 이연구재료는연세대학교치과대학구강병리학교실에서진단된구강편평세포암종환자 18예의조직을대상으로하였다. 각각의임상적및병리학적특성은 Table 1에정리하였다. 수술한암종조직에대한현미경관찰을하여외과적으로절제된이형성이없는경계부위를정상조직으로간주하였다. 정상조직에서침윤성암종으로이행되는부위에서이형성유무를관찰하였다. Table 1. Clinical and pathologic characteristics of the samples Case Age/Sex Primary site Differentiation Dysplasia L/N 1 67/F Lower gingiva WD /F Tongue MD /F Lower gingiva WD /M Tongue MD /M Lower gingiva PD /M Buccal cheek MWD /M Tongue WD /M Lower gingiva WD /F Lower gingiva WD /M Tongue WD /M Lower Lip MWD /M Lower gingiva PD /F Lower gingiva PMD /M Lower gingiva MWD /M Lower gingiva MWD /M Buccal cheek MWD /M Palatal mucosa MWD /M Mouth Floor MWD + + L/N: Lymph node metastasis, M: Male, F: Female, WD: Well differentiation, MD: Moderately differentiation, PD: Poorly differentiation MWD: Moderately to well differentiation, PMD: Poorly to moderately differentiation, - 5 -

14 나. 연구방법 ⑴ Laser capture microdissection(lcm) 을이용한세포추출 Silane coated slide glass를 70% ethanol에담근후 thermoplastic membrane을슬라이드에붙이고 Fixer Gum(Marabuwerke GmbH&Co, Germany) 으로접착시킨다음통상적인방법으로파라핀에포매된조직을 4μm두께로잘라 Hematoxylin/Eosin (H/E) 염색을시행하였다. 외과적절제의경계부위에서정상세포를, 이형성부위에서이형성세포를, 침윤성암종부위에서암종세포를, 경부림프절전이부위에서전이된암세포를각각 laser capture microdissection(lcm) 장비 (Zeiss, P.A.L.M. Mikrolaser technologie Biomateria. Pacific Co.Ltd) 를이용하여 0.5ml tube의뚜껑에분리하였다 (Figure 1). a. b c Dysplastic area This region is outlined by the Following the catapult removal laser beam of the samples into collecting vial the empty spaces of dysplastic cells - 6 -

15 b. Carcinoma area This region is outlined by the Following the catapult removal laser beam of the samples into collecting vial the empty spaces of tumor cells Figure 1. Histology of the microdissected samples. dysplastic area, carcinoma area ⑵ DNA 추출 모아진각각의세포로부터 QUIAGEN DNeasy tissue kit(quiagen Germany) 를이용하여 DNA를추출하였다. 200μl의 PBS를넣고 5분간원심분리하여세포를모은후 20μl proteinase K/200μl AL buffer를넣고 70 에서 30분간처리하였다. 10mg / ml RNase 40μl를넣고실온에서 2분간처리하였다. 100% 에틸알코올 200μl를넣고섞은후위용액을 collecting tube에옮겨원심분리하여용액을버리고 500μl의 AW1 buffer로씻고 500μl의 AW2 buffer로다시한번씻은후 50μl의 AE buffer로 DNA를추출하였다. 추출된 DNA는 -20 에보관하였다. ⑶ TβRⅡ 중합효소연쇄반응 각단계의세포로부터추출한 DNA 를주형으로하여 TβRⅡ 유전자의 exon 1~7-7 -

16 을중합효소연쇄반응 (polymerase chain reaction, PCR) 을시행하였다. 각단계세포의 DNA 2μl를사용하여 PCR mixture(takara, Japan) 로반응시켰다. 효소는 pfu-dna polymerase(mb1-fermentas) 를사용하였고 dntp(takara, Japan) 를첨가하여시행하였다. Exon 1~7 중합효소연쇄반응은 94 에서 4분간둔후변성반응을 94 에서 1분간, 결합반응을 50 ~ 58 에서 1분간, 중합반응은 72 에서 1분간 30주기를반복하고마지막중합반응은 72 에서 10분간연장하여반응시키고 4 에서반응을중지시켰다. PCR의효율을높이기위해 Nested PCR 을시행하였는데처음은 outer primer를이용하고두번째반응은 inner primer를이용하였다. 사용한 primer는 table2와같다. 양성대조군으로는 GAPDH를사용하였고음성대조군은 DNA를넣지않고중합효소연쇄반응을시행하였다. 중합효소연쇄반응산물은 ethidium bromide 처리된 1% agarose gel에서전기영동하여자외선조사하여확인하였다. Table 2. Primer sequences for TβRⅡ PCR Exon 1 Exon 2 Exon 3 Exon 4 upstream Exon 4 down stream Primer name Sequence Product(bp) Outer-F TGC GCT GGG GGC TCG GTC TAT 178 Inner-F TCG GTC TAT GAC GAG CAG Inner-R GGG ACC CCA GGA AGA CCC Outer-R GAG GCG GGG ACC CCA GGA A Outer-F CAA GTT CAT TTG AAA TTG C 306 Inner-F CAG GAA TTC ATT GGC AGG CTG Inner-R TGT GTG TAC TAT GAG AAT ACA TTA TGT Outer-R TTA CAT TTA GGA GAC AGA GAT ACA Outer-F TCT CCC CTC GCT TCC AAT 241 Inner-F TCC AAT GAA TCT CTT CAC TC Inner-R CCC ACA CCC TTA AGA GAA GA Ouer-R CAG ATC TCA GGT CCC ACA Outer-F CCA ACT CCT TCT CTC CTT GTT TTG 444 Inner-F TTT CCC CAA CAG AAT ATA ACA CC Inner-R GAA AGA TCT TGA CTG CCA CTG Outer-R TCC AAG AGG CAT ACT CCT CAT AGG Outer-F AAC ACA GAG CTG CTG CCC ATT GAG CT 568 Inner-F ATT GAG CTG GAC ACC CTG GTG GGG A Outer-R CCA GGC TCA AGG TAA AGG GGA TCT AGC A - 8 -

17 Exon 5 Exon 6 Exon 7 Outer-F CAG CTA TAT TGT GAA AAG AAA AAG GCA GC 261 Inner-F GGC AGC TGG AAT TAA ATG ATG GGC Inner-R TGC TCG AAG CAA CAC ATG Outer-R TTG TAA CCC CTG GAA TAA TGC TCG Outer-F TTT CCT TTG GGC TGC ACA TG 243 Outer-R CCT AAG AGG CAA CTT GGT TGA ATC Outer-F TTG CCT TCC GCG GAG CCC ACC AAC TAC T 252 Inner-F CCA ACT CAT GGT GTC CCT TTG Inner-R TCT TTG GAC ATG CCC AGC CTG Outer-R TTT GGT GAG AGG GGC AGC CTC TTT GGA ⑷ 염기서열분석 1% agarose gel에서전기영동에서확인된 TβRⅡ exon 1~7의중합효소연쇄반응한 DNA는 gel extraction kit(promega, USA) 를이용하여정제하였다. 중합효소연쇄반응산물은 DYEnamic ET Dye Terminator(Amersham Biosciences, USA) 를사용하여 labelling 한후 GP thermal cycle(takara Bio Inc, Japan) 를이용하여 PCR cycle을시행하였고 Sephadex G50 column을이용하여정제한후 MegaBACE 1000(Amersham Biosciences, USA) 장비로자동염기서열분석을하였다. (5) TβRⅡ 돌연변이에대한단백질구조분석 구조모델링방법 (Structrure modeling method): BLAST(Basic Local Alignment Search Tool) 와 FASTA3(version 3) 를이용하여유사한염기서열을갖는다른단백질을찾은뒤이중에서 3차원구조가알려진것을확인하고자 RCSB PDB(Protein data bank) 에서검색하였다. 검색결과 1PLO(Deep등 2003), 1KTZ(Hart등 2002), 1M9Z(Boesen 등 2002) 를찾을수있었다. 이중에서 1PLO 와 1KTZ를본단백질과의 sequence alignment와구조를기반으로 insightii (BIOSYM 의 3D graphical environment for molecular modeling package) 에서해 - 9 -

18 당되는영역의본단백질의삼차원구조를 homology modeling 하였다. 그후얻어진구조에서앞의실험에서발견되었던돌연변이가발생한부위를동일하게변이시킨뒤그구조를 energy minimization시켜서예상되는구조의변화를살펴보았다. 이때에 insight II에서 DISCOVER force field를사용하였다

19 Ⅲ. 연구결과 (1) 다단계구강암발암과정에서 TβRⅡ 의돌연변이분석 18 예의구강편평세포암종환자를대상으로암발생과정단계별로 TβRⅡ coding DNA 염기서열에해당되는 exon 1~7 에대한염기서열분석결과 exon 1, 2, 6 에서 는돌연변이가관찰되지않았고 3, 4, 5, 7 에서돌연변이가일어났다. 수용체의돌연변이유형은 14 건있었다. 10 건은 missense mutation 이었고 3 건은 silent point mutation 이었으며 1 건은 single nucleotide polymorphism(snp) 로확 인되었다 (Table 3, 4). 18예의구강편평세포암종중 2예의외과적절제의경계부인정상부위에서돌연변이가관찰되었다. Exon 4의 codon 170에서 ATC(Ile) 이 ACC(Thr) 으로바뀐 missense mutation이었다. Codon 170의돌연변이가정상부위에서부터나타나는것으로보아 SNP의가능성을생각할수있는데이는 NCBI DB와다른문헌에서는찾아볼수없는변이서열이었기때문에이를확인하기위해이부위에돌연변이를보였던환자의정상림프절에서 DNA를추출하여돌연변이분석을시행하였다. 림프절에서는돌연변이가관찰되지않아 SNP가아닌것으로간주하였다. 18예의구강편평세포암종중 6예의세포이형성부위에서여섯유형의돌연변이가관찰되었다. 1예는 exon 3의 codon 135에서 ATG(Met) 이 ACG(Thr) 로바뀐 missense mutation이었고 1예는 exon 4에서나타났으며 3건이었다. 1건은 codon 170에서 ATC(Ile) 이 ACC(Thr) 으로바뀐 missense mutation, 1건은 codon 222에서 GAT(Asp) 가 GGT(Gly) 로바뀐 missense mutation, 1건은 codon 234에서 AAC(Asn) 이 GAC(Asp) 로바뀐 missense mutation이었다. 2예는각각 exon 5의

20 codon 421(ACT(Thr) TCT(Ser)) 와 exon 7 의 codon 553 (TCG(Ser) TCT(Ser)) 에서나타난 silent mutation 이었다. 침윤성암종부위에서는 3 예의돌연변이가관찰되었는데 3 예모두 exon 4 에서나 타났으며 codon 170(ATC(Ile) ACC(Thr)), codon 186(TTC(Phe) TCC(Ser)), codon 205(AAG(Lys) GAG(Glu)) 에서 missense mutation 을보였다. 경부림프절전이가있었던총 9예의구강편평세포암종조직중 3예에서여섯유형의돌연변이가관찰되었다. 3예여섯유형의돌연변이모두 exon 4에서나타났다. Codon 170 (ATC(Ile) ACC(Thr)), codon 221 (GAA(Glu) GTA(Val)), codon 238 (AAC(Asn) ATC(Ile)), codon 227(ATC(Ile) ACC(Thr)), codon 236 (AAC(Asn) GAC(Asp)) 는 missense mutation이었고 codon 389 (AAC(Asp) AAT(Asp)) 에서는 silent mutation을보였다. Exon 4 의 Codon 191(Val Ile) 돌연변이는 8 예서관찰되었다. 정상세포에서 8 건, 이형성에서 6 건, 암세포에서 8 건, 전이된부위에서 4 건이관찰되었는데문헌확인 결과 single nucleotide polymorphism(snp) 으로밝혀졌다 (Watanabe 등 2002). 각돌연변이의아미노산변화는 Table4에정리하였다. 각아미노산의변화중 6건에서아미노산의 hydrophobicity 변화가관찰되었다. Exon 3의 codon 135, exon 4 의 codon 170, 186, 227은 hydrophobic 아미노산에서 hydrophilic 아미노산으로 exon 4의 codon 221, 238은 hydrophilic 아미노산에서 hydrophobic 아미노산으로변화되었다

21 Table 3. TβRⅡ mutations in oral squamous cell carcinomas Exon 1 Exon 2 Exon 3 No Dy Ca L/N No Dy Ca L/N No Dy Ca L/N ND ND - NA ND ND ND NA NA 3 ND NA ND NA ND NA ND NA - NA - NA 4 ND NA ND ND - NA ND - - NA ND ND ND NA ND ND ND NA NA 6 ND NA ND ND ND NA ND ND - NA ND ND - NA ND ND - NA NA NA ND ND - NA NA 9 - ND [135] ND NA - ND ND NA NA ND ND ND - ND ND ND - ND - ND ND - ND ND ND NA - ND ND NA NA 14 ND NA ND ND ND NA ND ND - NA ND ND ND NA ND ND ND NA NA ND ND ND ND NA - - ND NA - ND - NA 18 ND ND ND ND ND ND ND ND Exon 4(Up stream) Exon 4(Down stream) No Dy Ca L/N No Dy Ca L/N [221]/[238] - ND ND - 2 SNP191 SNP191 SNP191 NA - ND ND NA 3 - NA - NA ND NA ND NA 4 SNP191 NA SNP191 SNP191/[227/236] ND NA ND ND 5 SNP191 SNP191 SNP191 NA ND ND ND NA 6 SNP191 NA SNP191 SNP191 ND NA ND ND 7 SNP191 SNP191 SNP191 NA ND ND - NA 8 ND - [205] NA ND ND ND NA 9 SNP191 SNP191 SNP191 SNP191 ND ND - ND 10 SNP191 SNP191 SNP191 NA - ND ND NA 11 SNP191 SNP191 SNP191 SNP191 ND ND ND ND 12 - [222]/[234] - - ND ND ND ND NA ND ND - NA 14 - NA - ND ND NA ND ND 15 [170] [170] ND NA ND ND ND NA 16 ND [170] [170]/[186] [170] - ND - [389] 17 ND ND - NA - ND ND NA 18 [170] ND [170] ND ND ND ND ND

22 No: normal, Dy: dysplasia, Ca: Carcinoma, L/N: lymph node metastasis, NA; not available, ND: not determinant, -: negative Exon 5 Exon 6 Exon 7 No Dy Ca L/N No Dy Ca L/N No Dy Ca L/N 1 - ND ND NA NA - ND - NA 3 - NA - NA - NA - NA - NA ND NA 4 - NA NA NA ND - 5 ND - ND NA NA ND ND ND NA 6 - NA NA NA ND ND NA NA ND ND - NA 8 ND - - NA NA NA ND - ND ND NA NA - - ND NA 11 ND [421] ND ND - ND 12 ND ND ND NA NA - [553] ND NA 14 - NA NA - - ND NA ND ND 15 - ND ND NA ND ND ND NA ND ND ND NA ND ND NA - ND - NA - ND ND NA ND - - ND ND ND ND

23 Tabel 4. Amino acid changes in TβRⅡ mutation Exon Codon Mutation Hydrophobicity 변화 ATG[Methionine] ACG[Threonine] o ATC[Isoleucine] ACC[Threonine] o 186 TTC[Phenylalanine] TCC[Serine] o 205 AAG[Lysine] GAG[Glutamate] 221 GAA[Glutamate] GTA[Valine] o 222 GAT[Aspartate] GGT[Glycine] 227 ATC[Isoleucine] ACC[Threonine] o 234 AAC[Asparagine] GAC[Aspartate] 236 AAC[Asparagine] GAC[Aspartate] 238 AAC[Asparagine] ATC[Isoleucine] o 389 AAC[Asparagine] AAT[Asparagine] ACT[Threonine] TCT[Serine](silent mutation) TCG[Serine] TCT[Serine](silent mutation) Hydrophobic Hydrophilic Table 5. Incidence of missense mutations in multistep process Dysplasia Carcinoma L/N Exon 3 1 Exon Exon 5 1 Exon 7 1 L/N : Lymph node metastasis (2) TβRⅡ 돌연변이에대한단백질구조분석 위의돌연변이결과를토대로 exon 3 의 codon 135(Met-to-Thr) 의 missense

24 mutation이가져오는효과를살펴보기위해서 Swissprot DataBank에서얻은수용체의세포막외측부위아미노산서열 (figure 3) 을이용하여 Clustal X program 을이용한컴퓨터모델링을실시하였다. 분석결과단백질의삼차원구조가변화하였음을알수있었다 (figure 4, 5). 이위치의 methionine이 threonine으로변화됨으로인해표면의 potential이변화되었는데 hydrophobic patch가없어졌고주변의양전하와음전하의분포가약간변화된것을관찰할수있었다. Exon 4에서나타났던 missense mutation에대해서는이부위가 transmembrane, intracellular domain이걸쳐있는부위로, 이부위의중요성에대해서는아직까지잘알려져있지않고구조또한잘알려져있지않아이유형의돌연변이에대한삼차원적구조변화분석은수행할수없었다. 그러나 exon 4의 missense mutation 중 codon 186, 221, 227, 238은아미노산 의 hydrophobicity 가변화되었다. 이는단백질의구조가변화될수있는가능성을 제시한다고볼수있다. Figure 2. The structure of TβRⅡ gene

25 htβrⅡ mtβrⅡ rtβrⅡ ptβrⅡ ctβrⅡ xtβrⅡ FPQLCKFCDVRFSTCDNQKSCMSNCSITSICEKP...QEVCVAVWRKND.ENITLETVCH LPQLCKFCDVRLSTCDNQKSCMSNCSITAICEKP...HEVCVAVWRKND.KNITLETVCH LPQLCKFCDVTLSTCDNQKSCMSNCSVTSICEKP...QEVCVAVWRKND.KNITLETVCH LPQLCKRCDVRSSTCDNQKSCLSNCSITAICEKP...QEVCVAVWRKND.ENITIETVCD LPRLCKFCDVKATTCSNQDQCKSNCNITSICEKN...NEVCAAVWRRND.ENVTLETICH RTNVCKWCDNSHPVCDG.GICLTNCSLSSYCENP...EEICVTIWKEEN.ESLQLSTRCH mactrⅡ ETQECLFFNANWERD...TNQTGVEPPCYGDKDKRRHCFATWKNISGSIEIVKQGCW htβrⅡ mtβrⅡ rtβrⅡ ptβrⅡ ctβrⅡ xtβrⅡ DPKLPYHDFILEDAASPKCIMKEKKKPGETFFMCSCSSD.ECNDNIIFSEEYN DPKLTYHGFTLEDAASPKCVMKEKKRAGETFFMCACNNE.ECNDYIIFSEEYT DPKFTYHGFTLEDATSPTCVMKEKKRAGETFFMCSCNTE.ECNDYIIFNEEYT DPKIAYHGFVLDDAASSKCIMKERKGSGETFFMCSCSSD.ECNDHIIFSEEYA DTQKRLYGHMLDDSSSEQCVMKEKKDDGGLMFMCSCTGE.ECNDVLIFSAIDP HPLLLLENFLVPNYNTSLCVMSAMPSVSGRLYTCACTEEQECNDQLIFYNQSN mactrⅡ LDD...INCYDRTDCIEKKD...SPEVYFCCCEGN.MCNEKFSYFPEME Figure 3. Sequence alignment of the extracellular domains(ecd) from T βr Ⅱ species homologues. h-human, m-mouse, r-rat, p-pig, c-chicken, x-x.lavis. The sequence of mouse ActRⅡ ECD is also aligned. Cysteine residues are shown in bold. The eight Cys residues designated by black asterisks form four disulfide bonds that are structurally conserved in htβrⅡ and mactt Ⅱ.The arrow indicates the changed amino acid in this study

26 β1 β4 c β7 β5 c M β6 β2 β8 β3 Figure 4. The Structure of TβRⅡ: Normal TβRⅡ frame. Ribbon representation of the extracellular domain structure of TβR Ⅱ. Strands are numbered in the order in which they occur in the sequence

27 Figure 5. The Structure of TβRⅡ: codon 135 missense mutation. Surface representation of charge distribution and hydrophobic patches on the extracellular domain of TβRⅡ. Hydrophobic patches are colored yellow. Positive and negative charged patches are colored blue and red, respectively. Residue M135 and M135T are labelled in circle. The circled region has been magnified to show the change of electrostatic potential

28 Ⅳ. 총괄및고찰 두경부편평세포암종은전세계적으로매년약 500,000명의환자가존재하며그치료법이점점발전되고있다고는하지만진행된암의경우예후는 5년생존율이약 40% 로매우좋지않다 (Hall SF등 2000, Landis SH등 1999). 따라서예방과조기진단, 치료방법의선택및예후평가의유용성을위해서는암발생기전에대한이해가매우중요하다. TGFβ는발암과정에서암억제와암유발두가지기능을모두가진복합적인역할을하는것으로알려져있다. TGFβ가암억제에서암유발인자로변화되었다면이는반드시 TGFβ의성장억제기능에대한반응성이상실되어야하는데 TGFβ 기질이암발생초기와후기모두에서발현되기때문에이런반응성상실은수용체의변화에의한것으로생각할수있다. TGFβ는세포막에존재하는 Ⅰ형수용체 (Tβ RⅠ) 와 Ⅱ형수용체 (TβRⅡ) 의결합으로 Smad가활성화되어핵내로신호를전달한다. 따라서 TGFβ의신호전달체계와그기능의장애는발암과정에중요한역할을한다고생각된다 (de Castecker등 2000; Kelly등 1999). TGFβ의세포성장억제효과에대한저항력이인체암발생의한원인으로알려져있으며이러한저항력을얻게되는기전의하나로 TβRⅡ유전자의돌연변이가다양한암종세포주에서알려져있다.(Wrana등 1992; Munoz-Antoniz등 1996; Maestro등 1993; Markowitz등 1995; Grady등 1999; Wang등 1995; Ionov등 1993; Thiboeau등 1993; Furuta등 1993). 식도암, 위암, 췌장암에서 TβRⅡ유전자의돌연변이와같은유전적이상이보고되어수용체이상이상피세포기원의발암과정에서중요한기전으로작용할것으로제시된바있다 (Park등 1994). 그러나위장관계의암종과는달리두경부암종에서는아직까지 TβRⅡ의돌연변이연구는많지않은상태이다. Garrigue-Antar등은두경부편평세포암종세포주를사용한 TβRⅡ돌연변이연구에서 2개의세포주에서 missense mutation을보고하였고 (Garrigue-Antar등 1995),

29 Seijo등은두경부편평세포암종조직에서 TβRⅡ 전사시작부위의돌연변이연구에서 46% 의유전적변이를보고하였다 (Seijo등 2001). 또한 Wang등은 serine/threonine kinase domain에서 21% 의점돌연변이를보고하였다. 이들돌연변이에의한 TGFβ 신호체계의이상은두가지기전으로설명된다. 첫째, 암종세포주의돌연변이가 serine/threonine kinase domain에집중되어있어돌연변이가 Smad 유전자군의인산화과정을방해함으로써암발생과정에기여하리라고추측된다. 둘째, TβRⅡ 유전자의 missense 변이가아미노산의극성변화를유발하여단백질의구조적인 folding에영향을주거나 catalytic 활성이변함으로써 TβRⅡ 을인지하는능력에장애가생겨서세포내신호전달체계에이상이생겼을것으로추정하였다. 이연구에서는 TβRⅡ의 exon 1~7에대해돌연변이분석을하였다. 다단계암발생과정의어느시기에 TβRⅡ의변화가일어나는지를알아보기위해각단계의세포를레이저를이용하여분리하여돌연변이분석을시행하였다. 구강편평세포암종 1예에서 extracellular domain인 exon 3의이형성단계에서 missense mutation 이관찰되었고이의구조적변화를알아보기위한분석에서단백질의삼차원적구조변화가초래되었다. 돌연변이가일어난것으로밝혀진 methionine 135번 residue 는선행연구에서보고되고제안된것을근거로살펴볼때 (Guimond A 등 1999, Guimond A등 2002), TβRⅡ의 extracellular domain 중에서 TGFβ ligand가결합하거나, TβRⅠ과 tertiary complex를형성할때 TβRⅠ과상호작용을하게될것으로예상되는 amino acid residue에는속하지않고, 거리상으로도멀리떨어져서 TβRⅡ의 extracellular domain structure에서안쪽에위치하고있다. Methionine 135번 residue 주변에대한구조를비교해보면비활성구조에서는그위치를단백질표면에서확인할수있게표면에들어나있으나활성화된구조에서는 TGFβ 결합에의한구조변화의과정에서 methionine 135번 residue위에위치하던 loop가옆에위치하는 beta sheet와새로운 beta sheet을형성하면서서로간의거리가가까워지면서 methionine 135번 residue를덮어버리게되어단백질표면에서확인할수없게되는변화가일어나는것을확인할수있었다. 특히 T

30 βrⅡ의 extracellular domain 구조의 flexibility를 NMR 실험을근거로살펴본선행연구 (Deep등 2003) 에의하면 TβRⅡ 의 extracellular domain 구조를잡아주고있는 cysteine amino acid residue 사이의 disulfide bond와그아미노산주변의아미노산들의 flexibilitiy가 TβRⅡ의 extracellular domain이 TGFβ 기질과결합할때중요한역할을할것으로생각된다. Methionine 135번은이러한 disulfide bond에참여하는 cysteine amino acid residue바로옆에위치하고있다. 따라서 methionine 135번 residue가 threonine으로치환된것은이 135 위치의 flexibility 에큰영향을주게될것으로생각할수있다. 이러한돌연변이가 TβRⅡ의 extracellular domain과 TGFβ 기질사이의결합친화력을감소시켜세포증식을억제하지못하는결과를초래할수있으며따라서발암작용을촉진할수있는가능성을제시한다. TGFβ와그수용체는암발생과정에복합적인역할을하는것으로알려져있다. 상피에서 dominant negative TGFβ 수용체를갖는 transgenic mouse model( ΔβRⅡ) 을이용한실험에서 ΔβRⅡ mice는태어날때부터상피과증식이나과각화증이있었다. 이는 ΔβRⅡ가 TGFβ에의한상피증식억제기능이상실되었다는것을시사한다. ΔβRⅡ mice에서발암실험을한연구에서 12-O-tetradecanolyl-phobol-3- acetate(tpa) 처리만으로도유두종이형성되었는데이런결과는 ΔβRⅡ가발암과정의초기단계에영향을미쳤을것이라는가능성을제시한다. 이렇게유도된유두종에서는다른화학적발암단계의초기에보이는 c-ras돌연변이는관찰되지않았고 (DiGiovanni 1992) DMBA-TPA나 TPA-treated ras transgenic mice (Greenhalgh등 1996) 의한유두종보다더천천히형성되었기때문에 ΔβRⅡ의암의개시효과는약한것으로생각되는데위의실험은 TβRⅡ 신호전달체계의비활성화가피부발암과정의 predisposing event로작용한다는것을시사한다고볼수있다. 이실험에서 exon 3의 codon 135의단백질의삼차원적구조변화를수반하는 missense mutation이이형성부위에서발견되었고 exon 4에서도이형성부위에서 3건의 missense mutation이관찰되었다. 특히 exon 4의 codon 170의경우외과적절제의경계부위인정상부위에서도돌연변이가관찰되고한예에서는이

31 형성부위, 침윤성암종부위, 전이된암종부위에서순차적인돌연변이가관찰되었고또다른예에서는정상부위, 이형성부위에서순차적인돌연변이가관찰되었다. 정상부위에서부터돌연변이가관찰되어 single nucleotide polymorphism(snp) 의가능성을배제할수없어문헌고찰을하였는데 NCBI DB와다른문헌에는없는돌연변이서열이었기때문에이부위의돌연변이를보였던환자의정상림프절에서 DNA를추출하여돌연변이분석결과림프절에서는돌연변이가관찰되지않았다. 따라서이돌연변이가 SNP가아닌것으로생각하였다. 이돌연변이의아미노산변화를보면 isoleucine이 threonine으로변화되었는데이는 hydrophobic 아미노산에서 hydrophilic 아미노산으로변화된것으로정확한단백질구조분석을할수없지만 hydrophobicity의변화에의해 TGFβ에대한반응성이감소될가능성을시사한다고볼수있다. 이연구의결과로볼때 TβRⅡ의돌연변이가암을유발시키는직접적인인자로작용하는지에대해서는정확한근거를제시할수는없지만구강암발암과정의초기단계에서부터나타나는현상이고기질과의결합친화력의감소로인해발암과정에작용하는것으로생각할수있다. Exon 5 와 Exon 7 에서의나타난돌연변이역시이형성단계의세포에서관찰되었 으나 silent mutation 으로발암과정에큰의미는없을것으로생각된다. Exon 4는모든단계의세포에서돌연변이가관찰되었다. 특히 codon 191의돌연변이는정상세포군에서도높은빈도로나타나문헌고찰결과 SNP으로확인되었다 (Watanabe등 2002). 유방암, 전립선암, 간암등다양한암에서 TGFβ1 polymorphism과암발생위험, 예후등과연관된연구들이진행되었다. TGFβ1의 29번째 nucleotide에서 T-to-C transition은 polymorphism의하나로 leucine을 proline으로변화시켜혈청 TGFβ1 level을증가시킨다. 이런 polymorphism은중년여성의유방암발생위험을 20% 정도증가시킨다는연구가있고또다른 polymorphism인 509위치의 C-to-T transition은유방암위험을 25% 증가시킨다는연구가보고되어있다. TβRⅠ의 polymorphism과암과의연관성에관한연구는 Knobloch등이두경부편평세포암종의 43%(13/30) 에서 polymorphism이나타났

32 다고보고한문헌이있다 (Knobloch TJ 등 2001). TβRⅡ polymorphism과암발생위험과의연관관계를연구한문헌은보고되어있지는않지만 TβRⅡ polymorphism은 osteoporotic disorder의유용한지표로사용되고있다는보고가 (Watanabe등 2002) 있고 polycythaemia vera환자에서 TβRⅡ SNP를보고한연구가있다 (Juan L등 2001). 이연구에서 codon 191의 SNP는 44% 의높은빈도로나타났으며부위별로보면정상부위에서 8예, 이형성부위에서 6예, 암종부위에서 8예, 전이된부위에서 4예가관찰되는등높은빈도로나타났다. 아직까지 TβRⅡ 의 SNP와암과의연관성에대한연구자료는없지만이연구에서 SNP가높은빈도로나타난것은 SNP가구강편평세포암종의발생위험인자로작용했을가능성을시사하는것으로생각할수있다. Exon 4는 missense mutation이구강편평세포암종의 7예에서 10건이관찰되었고발생부위도이형성에서 3건, 침윤성암종부위에서 3건, 전이된암종부위에서 6건으로다양한부위에서관찰되었다. 그러나이부위는 transmembrane, intracellular domain이걸쳐있는부위로이부위의중요성에대해서는아직까지잘알려져있지않고구조역시잘알려져있지않아이유형의돌연변이에대한삼차원적구조변화분석은수행할수없었다. SNP(codon191) 를제외한 TβRⅡ의 missense mutation은 exon3, exon4, exon5, exon7에서각각이형성부위에서부터나타났고 exon 4의경우외과적절제의경계부위인정상부위에서도돌연변이가관찰되었다. Exon 3, exon 5, exon 7의경우이형성부위에서만돌연변이가관찰되었고다른돌연변이들도산발적으로다양한부위에서관찰되었다. 그러나 exon 4의 codon 170의경우이형성, 침윤성암종, 전이된암종부위에서순차적으로돌연변이가관찰된예가있었으며정상, 이형성부위에돌연변이가순차적으로나타난예도관찰되었다. 이런돌연변이가암종부위와전이된암종부위에서순차적으로나타나지않은예가많은것은암발생과정중다양한 subclone의출현으로설명할수있을것으로사료된다. Nerlich등은 laser microdissection을이용해서후두편평세포암종에서 TβRⅡ 돌연변이를관찰

33 한실험에서한환자의암종조직에서다섯부위를따로따로분리하여돌연변이분석을시행하였는데각부위에서서로다른돌연변이가관찰되었으며나타난돌연변이의종류도모두다른유형이었다 (Nerlich AG등 2003). 이들의연구결과도역시다양한 subclone의출현으로돌연변이를가진세포군들이세포성장에유리한조건을가지면서종양세포의성장을주도한다고설명하고있다. 지금까지의결과를종합해보면 TβRⅡ돌연변이는구강암발생과정중전암단계부터나타나며이돌연변이에의해단백질의삼차원적구조가변화되면서 TGFβ와의결합친화력을감소시켜세포증식을억제하지못하는결과를초래하여발암작용을촉진시켰을가능성을시사한다고본다

34 Ⅴ. 결론 구강내에서발생하는다단계편평상피암종의발생과정에서어느시기에 TβRⅡ변화가일어나는지일어난변화가어떤의미를갖는지를규명하기위해구강편평세포암종의각단계에해당하는세포를따로따로분류하여 DNA를추출하고수용체유전인자의 exon 1~7에대해중합효소반응과염기서열분석을통해 TβRⅡ 돌연변이를조사하고이런돌연변이가단백질의어떤구조변화를일으켰는지를분석하여다음과같은결론을얻었다. 다단계암발생과정중외과적절제부위인정상과이형성부위에서부터돌연변이가관찰된것으로보아 TβRⅡ의돌연변이는암발생과정의매우초기단계에서부터일어난것을알수있었고, 돌연변이에의해단백질의삼차원구조변화가일어나고아미노산의 hydrophobicity 변화가일어나면서 TGFβ와의결합친화력을감소시켜세포증식을억제하지못하는결과를초래하여발암작용을촉진한것으로사료되었다. 또한 exon 4에서 44% 의높은빈도로 SNP가관찰되어이는 cancer susceptibility 증가와관련이있을것으로사료된다

35 참고문헌 Alexandrow MG and Moses HL : Transforming growth factor β and cell cycle regulation. Cancer Res, 55: , 1995 Amanda ET, Chan JM, Yuan JW, Balmain A and Jing M : A gain of fundction TGFβ1 polymorphism may be associated with late stage prostate cancer. Cancer Epidemiol Biomarkers Prev, 13(5): , 2004 Attisano L, Wrana JL : Mads and Smads in TGFβ signalling. Current Opinion in Cell Biology:10: : 1998 Becker I, Becker KF, Rohrl MH, Minkus G, Schutze K, Hofler H: Single-cell mutation analysis of tumors from stained histologic slides. Lab Invest: 75: :1996 Bossen CC, Radaev S, Montyka SA, Patamawenu A, Sun PD: The 1.1A crystal structure of human TGFβ type Ⅱ receptor ligand binding domain. Structure:10: :2002 Bockmuhl U, Wolf G, Schmidt S, Schwendel A, Jahnke V, Deitel M, Petersen I: Genomic alteration associated with maligancy in head and neck cancer. Head Neck:20: :1998 Chen CR, Kang Y, Massague J: Defective repression of c-myc in breast cancer cells: A loss at the core of the trasnforming growth factor beta growth

36 arrest program. Proc. Natl. Acad.Sci. USA:98: ,2001 Chen RW, Moses HL, Maruoka M, Derynck R and Kawabata M : Phosphorylation-dependent interaction of the cytoplasmic domains of the type Ⅰ and type Ⅱ transforming growth factor β receptors. J Biol Chem: 270(20): , 1995 Chen T, Triplett J, Dehner B, Hurst B, Colligan B, Pemberton J, Gragg JR, Carter JH : Transforming growth factor-β receptor typeⅠ is frequently mutate in ovarian carcinomas. Cancer Res:61: :2001 Chih hu PP, Datto MB, Wang XF: Molecular mechanisms of transforming growth factor β signaling. Endocrine Reviews:19: :1998 de Castercker MP, Piek E and Roberts AB : Role of transforming grwoth factor β signaling in cancer. J Natl Inst Cancer, 92(17): , 2000 Deep S, Walker KP 3rd, Shu Z, Hinck AP : Solution structure and backbone dynamics of th TGF-beta typeⅡ receptor extracellular domain. Biochemistry, 42(34): , 2003 Deryneck R, Jarrett JA, Chen EY and Goeddel DV : The murine transforming growth factor-β precursor. J Biol chem:261: , 1986 DiGiovanni J: Multistage carcinogenesis in mouse skin. Pharmacol Ther : 54: ,1992 Fend M, Raffeld M : Laser capture microdissection in pathology. J Clin Pathol:

37 53: :2000 Field JK, Pavelic ZP. Spandidos DA, Stambrock PJ, Junes AD, Gluckmkan JL: The role of the p53 tumor suppressor gene in squamous cell carcinoma of the head and neck. Arch. Otolaryngol.Head Neck Surg: 119: :1993 Garrigue-Antar L, Munoz-Antonia T, Antonia SJ, Gesmonde J, Velluci VF and Reiss M : Missensse mutations of the transforming growth factor β type Ⅱ receptor in human head and neck squamous carcinoma cells. Cancer Res : 55(15) : , 1995 Gluckmkan JL, Lavelic ZP, Welkoborcky HJ, Mann W, Stambrook P, Gleich L, Wilson K, Righi P, Portugal LG, McDonald J, Biddinger P, Steward Dm Gartside P: Prognostic indicators for squamous cell carcinoma of the oral cavity: a clinicopathologic correlation. Laryngoscope: 107: :1997 Grady WM, Rajput A, Myeroff L, Liu DF, Kwon KH, Willis J, Markowtiz S : Mutation of the type Ⅱ transforming growth factor-β receptor is coincident with the transformation of human colon adenomas to malignant carcinoma. Cancer Res:58: :1998 Greenhalgh DA, Wang XJ, Donehower LA, Roop DR: Paradoxical tumor inhibitory effect of p53 loss in transgenic mice expressing epidermal-targeted v-rasha, v-fos, or human tansforming growth factor alpha. Cancer Res: 56: :1996 Guimond A, Sulea T, Pepin MC, O'connor-McCourt MD: Mapping of putative binding sites on the ectodermain of the type Ⅱ TGF β receptor by scaccnin

38 g-deletion mutagenesis and knowledge-based modeling. FEBS Letters: 456:79-84:1999 Guimomd A, Sulea T, Pen A, Ear P, O'connor-McCourt MD: Site-directed mutagenesis of the type Ⅱ TGF-β receptor indicates as ligand-binding site distinct from that of the type Ⅱ activin receptor. FEBS Letters:515:13-19:2002 Guimond A, Sulea T, Zwaagstra JC, Ekiel I, O'connor-McCourt MD: Identification of a functional site on the type Ⅰ TGF-β receptor by mutational analysis of its ectodomain. FEBS Letters:513: :2002 Hall SF, Groome PA, Rothwell D: The impact of comorbidity on the survival of patients with squamous cell carcinoma of the head and neck. Head Neck:22: :1999 Hart PJ, Deep S, Taylor AB, Shu Z, Hinck CS, Hinck AP: Crystal structure of the human TβR2 ectodomain-tgf-β3 complex. Nat Struct Biol: 9(3) : :2002 Izumoto S, Arita N, Ohnishi T, Hiraga S, Taki T, Tomita N, Ohue M, Hayahawa T : Microsatellite instability and mutated type Ⅱ transforming growth factor-β receptor gene in gliomas. Cancer Letters:11: :1997 Jeremy NR, Anita JB and Xiao FW : Transformin growth factor-β signaling in cancer. Microscopy Res Tech, 52: , 2001 Juan L, Anthony J, Brian JPH, Anthony R : Mutation and methylation analysis of the transforming growth factor β receptor Ⅱ gene in polycythaemia vera

39 British J Haematol: 115: :2001 Kakonen SM, Selander KS, Chirgwin JM, Yin JJ, Burns S, Rankin WA, Grubbs BG, Dallas M, Cui Y, Guise TA : Transforming growth factor-β stimulates parathyroid hormone-related protein and osteolytic metastasis via Smad and mitogen-activated protein kinase signaling pathways. J Biol. Chem:277: :2002 Kim SJ, Im YH, Markowitz SD, Bang YJ : Molecular mechanism of inactivation of TGF-β receptors during carcinogenesis. Cytokine Growth Factor Rev :11: :2000 Knobloch TJ, Lynch MA, Song HJ, DeGroff VL, Casto BC, Adams EM, Alam KY, Land JC, Schuller DE and Weghorst CM : Analysis of TGFβ type Ⅰ receptor for mutations and polymorphism in head and neck cancers. Mutation Res: 479: , 2001 Knobloch TJ, Lynch MA, Song HJ, DeGroff VL, Casto BC, Adams EM, Alam KY, Lang JC, Schuller DE, Weghorst CM : Analysis of TGF-β type Ⅰ receptor for mutations and polymorphism in head and neck cancers. Mutation Res:479: : 2001 Kondo M, Suzuki H, Takehara K, Miyazono K and Kato M : Transforming growth factor-β signaling is differentially inhibited by Smad2D450E and Smad3D407E. Cancer Sci:95:12-17: 2004 Landis SH, Murray T, Bolden S, Wingo PA : Cancer statistics. CA Cancer J. Clin:49:8-31:

40 Lloyd RV: Laser Capture Microdissection; Principles and applications. Morphology methods :Cell and Molecular Biology Technique:11-25 Lucke CD, Philpott A, Metclfe JC, Thompson AM, Davies LH, Kemp PR, Hesketh R: Inhibiting mutations in the transforming growth factor β type 2 receptor in recurrent human breast cancer. Cancer Res:61: :2001 Massague J : Receptors for the TGF β family. Cell:69: , 1992 McEarchern JA, Kobie JJ, Mack V, Su RS, Meade-Tollin L, Arteaga CL, Dumont N, Besselsen D, Seftor E, Hendrix MJ: Invasion and metastasis of a mammary tumor involves TGF-beta signaling. Int.J. Cancer:91:76-82:2001 Mooustakas A, Pardali K. Gaal A, Heldin CH : Mechanism of TGFβ signaling in regulation of cell growth and differentiation. Immunol Letters:82:85-91, 2002 Muro-Cacho CA, Anderson M, Cordero J, Munoz-Antonia T: Expression of transforming growth factor β type Ⅱ receptors in head and neck squamous cell carcinoma. Clin Cancer Res:5: , 1999 Muro-Cacho CA, Rosario-Ortiz K, Livingston S, Munoz-Antonia T: Defective transforming growth factor β signaling pathway in head and neck squamous cell carcinoma as evidenced by the lack of expression of activated Smad2. Clin Cancer Res:7: , 2001 Nerlich AG, Sauer U, Rouss I and Hagedorn HG : High frequency of TGFβ receptor-Ⅱ mutations in microdissected tissue samples from laryngeal

41 squamous cell carcinomas. Laboratory investigation: 83(8) : , 2003 Orimo H, Ikejima M, Nakajima E, Emi M, Shimada T : A novel missense mutation and frameshift mutations in the typeⅡ receptor of transforming growth factor-β gene in sporadic colon cancer with miscrosatellite instability. Mutation Res Geno:382: :1998 Park K Kim SJ, Bang YJ, Park JG, Kim NK, Roberts AB, Sporn MB : Genetic changes in the transforming growth factor β(tgf-β) type Ⅱ receptor gene in human gastric cancer cells : Correlation with sensitivity to growth inhibition by TGF-β. Proc. Natl. Acad. Sci. USA:91: , 1994 Parsons R, Myeroff LL, Willson JKL, Markowitz SD, Kinzler KW, Vogelstein B : Mircrosatellite instability and mutations of the transforming growth factor β type Ⅱ receptor gene in colorectal cancer. Cancer Res : 55: :1995 Piffko J, Bankfalve A, Joos U, Ofner D, Krassort M, Schmid KW: Immunophenotypic analysis of normal mucosa and squamous cell carcinoma of the oral cavity. Cancer Detect Prev:23:45-56:1999 Rich JN, Borton AJ, Wang XF : Transforming growth factor-β signaling in cancer. Microscopy Res and Tech:52: :2001 Role of TGF β in oncogenesis. Microscopy Res and Tech:52:353:2001 Rooke HM, Vitas MR, Crosier PS, Crosier KE : The TGF-β type Ⅱ receptor in chronic myeloid leukemia: analysis of microsatellite regions and gene expression. Leukemia:13: :

42 Sæterdal I, Bjørheim J, Lislerud K, Gjertsen MK, Bukholm IK, Olsen OC, Nesland JM, Eriksen JA, Møller M, Lindblom A, Gaudernack G: Frameshift mutation derived peptides as tumor specific antigens in inherited and spontaneous colorectal cancer. PNAS:98: :2001 Shin KH, Park YJ and Park JG : Mutational analysis of the transforming growth factor β receptor type Ⅱ gene in hereditary nonpolyposis colorectal cancer and early-onset colorectal cancer patients. Clinical Cancer Res: 6: : 2000 Siegel PM, Shu W, Cardiff RD, Muller WJ, Massague J : Transforming growth factor β signaling impairs neu-induced mammary tumorigenesis while promoting pulmonary metastasis. Proc. Natl. Acad. Sci. USA:100: :2003 Sijo ER, Song HJ, Lynch MA, Jennings R, Qong X, Lazaridis E, Weghorst CM : Identification of genetic alterations in the TGF β type Ⅱ receptor gene promoter. Mutation Res : 483: 19-26, 2001 Sporn MB, Roberts AB : TGF-β problems and prospects. Cell Regul: 1: :1990 Wakefield LM, Robert AB : TGF-β signaling : positive and negative effects on tumorigenesis. Curr opinion in genetics & development : 12:22-29, 2002 Wang D, Song HJ, Evans JA, Lang JC, Schuller DE and Weghorst CM : Mutation and downregulation of the transforming growth factor β type Ⅱ receptor gene in primary squamous cell carcinomas of the head and neck

43 Carcinogenesis:18: : 1997 Wang D, Tatsuya K, Hideki M, Fumilo T, Yoshito I, Norio W, Akita M, Yoshimori S, Seiichi T: Analysis of specific gene mutations in the transforming growth factor-β signal transduction pathway in human ovarian cancer. Cancer Res:60: :2000 Wang XJ : Role of TGFβ signaling in skin carcinogenesis. Microscopy REs and Tech : 52: :2001 Watanabe Y, Kinoshita A, Yamada T, Ohta T, Kishino T, Mastamoto N, Ishikawa M, Miikawa N and Yoshiura KI : A tatalog of 106 single-nucleotide polymorphisms(snps) and 11 other types of variations in genes for transforming growth factor-β1(tgf-β1) and its signaling pathway. J Hum Genet: 47: , 2002 Welch DR, Rabra A, Nakajima M : Transforming growth factor β stimulates mammary adenocarcinoma cell invasion and metastatic potential. Proc. Natl. Acad. Sci. USA: 87: :1990 Wrana JL, Attisano L, Carcamo J, Zentella A, Doody J, Laiho M, Wang XF and Massague J : TGFβ signal as through a heteromeric protein kinase receptor complex. Cell: 69: , 1992 Wrana JL, Attisano L, Wieser R, Ventura F, Massague J : Mechanism of activation of the TGF-β receptor. Nature: 370: :1994 Yigong S, Joan M : Mechanisms of TGFβ signaling from cell membrane to the

44 nucleus. Cell, 113: , 2003 Yin JJ, Selander K, Chirgwin JM, Dallas M, Grubbs BG, Wieser R, Massague J, Mundy GR, Guise TA : TGF-β signaling blockade inhibits PTHrP secretion by breast cancer cells and bone metastasis development. J Clin. Invest.:103: :

45 ABSTRACT Mutation analysis of trasnforming growth factor beta type Ⅱ receptor based on multistep process of oral squamous cell carcinoma EUNHA LEE Departments of Dental Science, Graduated school, Yonsei university ( Directed by Prof. Jin Kim D.D.S., Ph. D. ) The role of transforming growth factor β (TGFβ) family members in carcinogenesis is complex. A widely accepted concept suggests that a critical step of carcinogenesis is the deregulation of TGFβ action and its signaling function. We have previously observed mutation of TGFβ type Ⅱ receptor(tβ RⅡ) gene in Oral squamous cell carcinoma(oscc) cell lines. In the present study, 18 cases of OSCC were used for genetic mutation analysis of TβRⅡ. Focused on multistep process, each area was selected by normal surgical margin, dysplastic lesion, carcinoma and metastatic cancer cells by laser captured microdissection(lcm). Exon specific spanning primers of exon 1, 2, 3, 4, 5, 6, 7 were used for PCR amplification of the genomic DNA and each of the amplified sequences were analyzed for their mutation sites. The structure of TβRⅡ ectodomain was analyzed by structure modeling method

46 The results were as follows : 1. The genetic mutations were found in 6 cases of dysplastic area. In one case, mutation was found in exon3(extracellular domain) at codon 135[Met to Thr] which induced the structural change in extracellular domain of the receptor. In 3 cases, missense mutations were found in exon4. One of them showed the alteration of hydrophobicity of amino acid. The genetic change in exon5 and exon7 was silent mutation. 2. The mutations were found in 3 cases of invasive carcinoma area. Those were located in exon 4 at codon 170, codon 186 and codon The mutation was observed in 3 cases of metastatic area within lymph node. Six kinds of mutation were found in exon4 at codon 170codon 221, codon 227,codon 236, codon 238, codon The most common site of genetic change was codon 191(Val to Ile) of exon 4 which was found in eight cases throughout normal surgical margin, dysplastic lesion, carcinoma and metastatic cancer cells. This mutation was turned out single nucleotide polymorphism(snp). These results suggest that TβRⅡ mutations occur in early stage of tumor development and TβRⅡ polymorphisms may contribute to the susceptibility for cancer development. Key words: TGFβ1 type Ⅱ receptor, mutations, multistep process, oral squamous cell carcinomas

ƯÇãû

ƯÇãû '' - 1 - - 2 - - 3 - - 4 - - 5 - ' - 6 - - 7 - - 8 - - 9 - - 10 - - 11 - Super-Bio Co., Ltd. KWON, Suk-Tae Thermostable DNA Polymerase-encoding Gene from Thermus sp. X-1 an d Amino Acid Sequence

More information

2016 학년도약학대학면접문제해설 문제 2 아래의질문에 3-4분이내로답하시오. 표피성장인자수용체 (epidermal growth factor receptor, EGFR) 는수용체티로신인산화효소군 (receptor tyrosine kinases, RTKs) 의일종으로서세

2016 학년도약학대학면접문제해설 문제 2 아래의질문에 3-4분이내로답하시오. 표피성장인자수용체 (epidermal growth factor receptor, EGFR) 는수용체티로신인산화효소군 (receptor tyrosine kinases, RTKs) 의일종으로서세 본문제에대한지적소유권은동국대학교에있습니다. 본교의서면허락없이무단으로출판, 게재, 사용할수없습니다. 문제 2 2016 학년도약학대학면접문제 아래의질문에 3-4 분이내로답하시오. 표피성장인자수용체 (epidermal growth factor receptor, EGFR) 는수용체티로신 인산화효소군 (receptor tyrosine kinases, RTKs) 의일종으로서세포의생존과증식

More information

- 2 -

- 2 - - 2 - - 3 - - 4 - ➀ - 5 - - 6 - α - 7 - - 8 - - 9 - - 10 - - 11 - - 12 - - 13 - - 14 - - 15 - - 16 - - 17 - - 18 - - 19 - - 20 - μ - 21 - ➀ - 22 - - 23 - - 24 - α - 25 - - 26 - - 27 - μ - 28 - μ μ - 29

More information

Jkbcs016(92-97).hwp

Jkbcs016(92-97).hwp Expression of bcl-2 and Apoptosis and Its Relationship to Clinicopathological Prognostic Factors in Breast Cancer - A Study with Long Term Follow-up correlated with the survival rate.(journal of Korean

More information

Jkbcs032.hwp

Jkbcs032.hwp Clinical Correlation of HER-2/neu Overexpression in Patients with Breast Cancer Sung Yong Kim, Tae Yoon Kim, Jae Jun Kim, Chang Ho Kim, Ok Pyung Song, Min Hyuk Lee, Eui Han Kim 1, and Moo Sik Cho Departments

More information

Can032.hwp

Can032.hwp Chromosomal Alterations in Hepatocellular Carcinoma Cell Lines Detected by Comparative Genomic Hybridization Sang Jin Park 1, Mahn Joon Ha, Ph.D. 1, Hugh Chul Kim, M.D. 2 and Hyon Ju Kim, M.D. 1 1 Laboratory

More information

- 2 -

- 2 - - 2 - α - 3 - - 4 - α - 5 - - 6 - - 7 - - 8 - - 9 - - 10 - - 11 - 번호 유효성분 차나무오일 코퍼설페이트펜타하이드레이트 폴리옥신디 - 12 - - 13 - μ - 14 - α m α α μ - 15 - μ μ - 16 - m μ - 17 - - 18 - - 19 - μ - 20 - μ μ μ - 21 - -

More information

F. Sequencing FSequencing 01. Sequencing Service DNA sequencing Phone: (ext.4 4)

F. Sequencing FSequencing 01. Sequencing Service DNA sequencing Phone: (ext.4 4) FSequencing 01. DNA sequencing Phone: 1588-9788 (ext.4 4) E-mail: sequencing@bioneer.co.kr 01. 242 FAQs 247 개요 상세 설명 바이오니아는 국내 최초로 를 시작하였으며, 매년 개선된 high-throughput sequencing service를 제공하고 있습니다. Plasmid

More information

l l l l l l l l l Lee, Geon Kook None This project was designed to establish the Tumor Bank of National Cancer Center in 2000. From the first tumor sample in 2000, the total of tumor and tumor-related

More information

( )Jkstro011.hwp

( )Jkstro011.hwp 비인강암의방사선치료결과및생존율에관한예후인자분석 2005 2 1 2005 3 28. :, Tel: 053)250-7665, Fax: 053)250-7984 E-mail: jhkim@dsmc.or.kr 정영연외 2 인 : 비인강암의예후인자분석 정영연외 2 인 : 비인강암의예후인자분석 Carcinoma of the nasopharynx treated by radiotherapy

More information

Microsoft PowerPoint - 김미영

Microsoft PowerPoint - 김미영 암세포의위험한여행 한국과학기술원 김미영 강의개요 전이란무엇인가? 전이는어떤과정을통해진행될까? 전이예측방법은어떤것들이있을까? Cancer ( 악성종양 ) US South Korea 질병사망률질병사망률 1. 심장병 26% 1. Cancer 26.7% 2. Cancer 23% 2. 뇌출혈 12.7% 3. 뇌출혈 5.6% 3. 심장병 7.9% >20,000 환자가악성종양에의해매일사망함

More information

Δ Epidermal growth factor receptor (EGFR) is well established target for cancer treatment and EGFR tyrosine kinase (TK) inhibitors such as gefinitib and elotinib have been developed as anti-cancer drugs.

More information

135 Jeong Ji-yeon 심향사 극락전 협저 아미타불의 제작기법에 관한 연구 머리말 협저불상( 夾 紵 佛 像 )이라는 것은 불상을 제작하는 기법의 하나로써 삼베( 麻 ), 모시( 苧 ), 갈포( 葛 ) 등의 인피섬유( 靭 皮 纖 維 )와 칠( 漆 )을 주된 재료

135 Jeong Ji-yeon 심향사 극락전 협저 아미타불의 제작기법에 관한 연구 머리말 협저불상( 夾 紵 佛 像 )이라는 것은 불상을 제작하는 기법의 하나로써 삼베( 麻 ), 모시( 苧 ), 갈포( 葛 ) 등의 인피섬유( 靭 皮 纖 維 )와 칠( 漆 )을 주된 재료 MUNHWAJAE Korean Journal of Cultural Heritage Studies Vol. 47. No. 1, March 2014, pp.134~151. Copyright 2014, National Research Institute of Cultural Heritage 심향사 극락전 협저 아미타불의 제작기법에 관한 연구 정지연 a 明 珍 素 也

More information

중합효소연쇄반응 (polymerase chain reaction:pcr) 에의한 HPV와 EBV의검출 Table 1. Oligonucleotide primers of PCR for HPV and EBV Nucleotide sequence Product size Huma

중합효소연쇄반응 (polymerase chain reaction:pcr) 에의한 HPV와 EBV의검출 Table 1. Oligonucleotide primers of PCR for HPV and EBV Nucleotide sequence Product size Huma KISEP Head and Neck Korean J Otolaryngol 2001;44:0611 상악암에서중합효소연쇄반응을이용한인형유두종바이러스와 EpsteinBarr Virus 의검출 조재식 임상철 정형수 임회정 김정현 The Detection of Human Papillomavirus and EpsteinBarr Virus DNA in Maxillary

More information

°ø±â¾Ð±â±â

°ø±â¾Ð±â±â 20, 30, 40 20, 30, 40 1 2 3 4 5 6 7 8 9 10 3.1 6.3 9.4 12.6 15.7 18.8 22.0 25.1 28.3 31.4 2.4 4.7 7.1 9.4 11.8 14.1 16.5 18.8 21.2 23.6 7.1 14.1 21.2 28.3 35.3 42.4 49.5 56.5 63.6 70.7 5.9 11.9 17.8 23.7

More information

388 The Korean Journal of Hepatology : Vol. 6. No COMMENT 1. (dysplastic nodule) (adenomatous hyperplasia, AH), (macroregenerative nodule, MR

388 The Korean Journal of Hepatology : Vol. 6. No COMMENT 1. (dysplastic nodule) (adenomatous hyperplasia, AH), (macroregenerative nodule, MR 6 3 2000 ; 387-392 (3) Dysplastic Nodule Young Nyun Park, M.D., Chanil Park, M.D. Department of Pathology, Yonsei University College of Medicine BRIEF HISTORY 56. AST/ALT 72/73 IU/L, total bilirubin 0.7

More information

연하곤란

연하곤란 2015.03.04 부울경소화기내시경지회 Intramucosal gastric cancer: The rate of lymph node metastasis in signet ring cell carcinoma was as low as that in welldifferentiated adenocarcinoma 인제대부산백병원 소화기내과 지삼룡 Signet ring

More information

Microsoft Word doc

Microsoft Word doc KISEP Rhinology Korean J Otolaryngol 2006;49:307-12 사람정상코점막상피세포에서겔형성점소 (Gel-Forming Mucin) 분비에대한 Prostaglandin E 2 의효과 김진국 1 김창훈 2,3 김규보 2 장현종 1 김현직 2 윤주헌 2,3,4 Effect of Prostaglandin E 2 on Gel-forming

More information

주의내용 주 의 1. 이보고서는질병관리본부에서시행한학술연구용역사업의최종결 과보고서입니다. 2. 이보고서내용을발표할때에는반드시질병관리본부에서시행한 학술연구용역사업의연구결과임을밝혀야합니다. 3. 국가과학기술기밀유지에필요한내용은대외적으로발표또는공개 하여서는아니됩니다.

주의내용 주 의 1. 이보고서는질병관리본부에서시행한학술연구용역사업의최종결 과보고서입니다. 2. 이보고서내용을발표할때에는반드시질병관리본부에서시행한 학술연구용역사업의연구결과임을밝혀야합니다. 3. 국가과학기술기밀유지에필요한내용은대외적으로발표또는공개 하여서는아니됩니다. 편집순서 1 : 겉표지 학술연구용역사업최종결과보고서 과 원외폐렴원인균조사및내성감시 시스템구축 주의 ( 주의내용기재 ) ( 글 14 point 고딕체 ) 제명 2 0 0 Microbiological Etiology of Community acquired pneumonia and Surveillance network of resistance 주관연구기관 : 울산대학교의과대학

More information

Kaes017.hwp

Kaes017.hwp 갑상선의 Poorly Differentiated (Insular) Carcinoma Insular Carcinoma: An Aggressive Subtype of Differentiated Thyroid Neoplasms Seok-Jin Nam, M.D., Sang-Dal Lee, M.D., Hal-lin Park, M.D., Young-Ryun Oh, M.D.

More information

MHC T cell Receptor Antigen Antigen-presenting cell Antigen-reactive T cell CD28 B7 Activation (proliferation Cytokine production Cytotoxicity) Antigen-presenting cell Antigen-reactive T cell Dormant State

More information

공학박사학위 논문 운영 중 터널확대 굴착시 지반거동 특성분석 및 프로텍터 설계 Ground Behavior Analysis and Protector Design during the Enlargement of a Tunnel in Operation 2011년 2월 인하대

공학박사학위 논문 운영 중 터널확대 굴착시 지반거동 특성분석 및 프로텍터 설계 Ground Behavior Analysis and Protector Design during the Enlargement of a Tunnel in Operation 2011년 2월 인하대 저작자표시-비영리-동일조건변경허락 2.0 대한민국 이용자는 아래의 조건을 따르는 경우에 한하여 자유롭게 이 저작물을 복제, 배포, 전송, 전시, 공연 및 방송할 수 있습니다. 이차적 저작물을 작성할 수 있습니다. 다음과 같은 조건을 따라야 합니다: 저작자표시. 귀하는 원저작자를 표시하여야 합니다. 비영리. 귀하는 이 저작물을 영리 목적으로 이용할 수 없습니다.

More information

DNA의추출 Table 1. Sequences of oligonucleotide primers Primers L1 consensus primer Sequence CGT CCM ARR GGA WAC TGA TC Size of amplified products

DNA의추출 Table 1. Sequences of oligonucleotide primers Primers L1 consensus primer Sequence CGT CCM ARR GGA WAC TGA TC Size of amplified products KISEP Rhinology Korean J Otolaryngol 2000;43:836-43 비 부비동반전성유두종에서인유두종바이러스및 Epstein-Barr 바이러스의검출과 p53 단백및 Proliferating Cell Nuclear Antigen 의발현 조진희 서병도 전범조 장한성 양명재 윤희로 노우영 Detection of Human Papillomavirus

More information

(079-088)Kjbt015.hwp

(079-088)Kjbt015.hwp 대한수혈학회지:제18권 제2호, 2007 다중 단일염기 시발체 확장반응을 이용한 ABO 유전자형 검사 현정원 1 장호은 2 허세란 2 송상훈 1 박경운 1,2 송정한 1,2 한규섭 1 = Abstract = 서울대학교 의과대학 검사의학교실 1, 분당서울대학교병원 진단검사의학과 2 ABO Genotyping using a Multiplex Single-base

More information

내시경 conference

내시경 conference 부울경소화기내시경학회 6월집담회 고신대학교복음병원소화기내과전임의서광일 F/63 CASE C.C) epigastric pain for 2 wks P. I) 2014.04.16 EGD at LMC adm via OPD for further evaluation. P. Hx) CASE HTN/DM/Hepatitis/Tbc (+/+/-/-) S. Hx) N-S ROS)

More information

Lumbar spine

Lumbar spine Lumbar spine CT 32 111 DOI : 10.3831/KPI.2010.13.2.111 Lumbar Spine CT 32 Received : 10. 05. 23 Revised : 10. 06. 04 Accepted : 10. 06. 11 Key Words: Disc herniation, CT scan, Clinical analysis The Clinical

More information

<303720C7CFC1A4BCF86F6B2E687770>

<303720C7CFC1A4BCF86F6B2E687770> 1) < 論 文 > 라이프스타일 세분화를 통한 실버타운 수요자 분석 133 주택연구 제15권 4호 2007. 12/15(4) : 133~160 Housing Studies Review Vol. 15, No. 4 : 133~160 접수일 : 2007. 7. 9, 심사일 : 2007. 7. 16, 심사완료일 : 2007. 8. 29 라이프스타일 세분화를 통한 실버타운

More information

두경부 편평세포암에서 p16, Cyclin D1 단백의 발현양상 부 편평세포암에서 p16단백의 표현양상과 임상병기 및 조 4-326(BioGenex, USA), p16은 쥐 단클론 항체인 G17 직분화도에 따른 표현양상의 차이를 알아보고 cyclin D (P

두경부 편평세포암에서 p16, Cyclin D1 단백의 발현양상 부 편평세포암에서 p16단백의 표현양상과 임상병기 및 조 4-326(BioGenex, USA), p16은 쥐 단클론 항체인 G17 직분화도에 따른 표현양상의 차이를 알아보고 cyclin D (P KISEP Head and Neck Korean J Otolaryngol 1998;417:901-905 두경부편평세포암에서 p16, Cyclin D1 단백의발현양상 김상현 박숙아 오영석 Expression of p16 Protein and Cyclin D1 Protein in Head and Neck Squamous Cell Carcinomas Sang Hyun

More information

7월웹진

7월웹진 최근연구소식 최근의연구동향을이해할수있도록몇편의논문을요약하여하나의주제로소개합니다. 새로운항암치료타겟인 c-met 저해제의연구현황 Livio Trusolino, Andrea Bertotti and Paolo M. Comoglio (2010) MET signalling: principles and function in development, organ regeneration

More information

386-390.hwp

386-390.hwp 386 HANYANG MEDICAL REVIEWS Vol. 29 No. 4, 2009 우리나라 미숙아의 통계와 의료비용 Statistics and Medical Cost of Preterm in Korea 윤혜선 을지대학교 노원을지병원 소아청소년과학교실 Hye Sun Yoon, M.D., Ph.D., Department of Pediatrics, Nowon

More information

歯1.PDF

歯1.PDF 200176 .,.,.,. 5... 1/2. /. / 2. . 293.33 (54.32%), 65.54(12.13%), / 53.80(9.96%), 25.60(4.74%), 5.22(0.97%). / 3 S (1997)14.59% (1971) 10%, (1977).5%~11.5%, (1986)

More information

구강암에서 p53, p21, Bax 단백의 발현양상 및 예후와의 연관성 요구되고 있다.5) 이미 Apolinario 등1)과 Lee 등2)은 면역 (Calbio, England)를 1 20으로, bax에 대한 일차항체로 조직화학적으로 단백발현된 양상과 생존률과의 비교연

구강암에서 p53, p21, Bax 단백의 발현양상 및 예후와의 연관성 요구되고 있다.5) 이미 Apolinario 등1)과 Lee 등2)은 면역 (Calbio, England)를 1 20으로, bax에 대한 일차항체로 조직화학적으로 단백발현된 양상과 생존률과의 비교연 KISEP Head and Neck Korean J Otolaryngol 2000;43:523-7 구강편평세포암에서 p53, p21, Bax 단백의면역조직화학적발현양상및예후적의의 김상현 황동조 김정수 문준환 노호상 The Expression Pattern and the Prognostic Value of p53, p21, and Bax Proteins in

More information

- i - - ii - - iii - - iv - - v - - vi - - 1 - - 2 - - 3 - 1) 통계청고시제 2010-150 호 (2010.7.6 개정, 2011.1.1 시행 ) - 4 - 요양급여의적용기준및방법에관한세부사항에따른골밀도검사기준 (2007 년 11 월 1 일시행 ) - 5 - - 6 - - 7 - - 8 - - 9 - - 10 -

More information

이발명을지원한국가연구개발사업 과제고유번호 부처명 농촌진흥청 연구관리전문기관 연구사업명 현장협력기술개발사업 연구과제명 저항성유전자의개발및이용 기여율 주관기관 경희대학교 연구기간 ~

이발명을지원한국가연구개발사업 과제고유번호 부처명 농촌진흥청 연구관리전문기관 연구사업명 현장협력기술개발사업 연구과제명 저항성유전자의개발및이용 기여율 주관기관 경희대학교 연구기간 ~ (19) 대한민국특허청 (KR) (12) 공개특허공보 (A) (11) 공개번호 10-2010-0103000 (43) 공개일자 2010년09월27일 (51) Int. Cl. C12N 9/10 (2006.01) C12N 15/54 (2006.01) C07K 14/415 (2006.01) A01H 1/00 (2006.01) (21) 출원번호 10-2009-0021349

More information

KD2002-29-02.hwp

KD2002-29-02.hwp 韓 國 敎 育 요 약 학술 논문.,......,.,,,......., (, 1999).. ...,.,.,,,.,,,,, (, 1990).,,. (,, 1999)...,...,,,.,,.,.. (, 1999),,., 학술 논문....,., (, 1998).., (Keeves, 1997)...,...,.,,.,... (, 1970). .,,,,,.,,,,...,,,,,..

More information

<28C3D6C1BE29312DC0CCBDC2BEC62E687770>

<28C3D6C1BE29312DC0CCBDC2BEC62E687770> 한국패션디자인학회지 제9권3호 The Korean Society of Fashion Design Vol. 9 No. 3 (2009) pp.1~12 소니아 리키엘 컬렉션에 나타난 니트웨어 색채 특성 The Color Characteristics of Knit Wear Shown in Sonia Rykiel s Collections 이 승 아ㆍ조 주 연ㆍ이 연

More information

발간등록번호 상황버섯으로유도된 FMO3 와 Corin 에의한 농약분해및혈압저하유도

발간등록번호 상황버섯으로유도된 FMO3 와 Corin 에의한 농약분해및혈압저하유도 발간등록번호 11-1543000-002003-01 상황버섯으로유도된 FMO3 와 Corin 에의한 농약분해및혈압저하유도 농림축산식품부장관귀하 본보고서를 상황버섯으로유도된 FMO3 와 Corin 에의한농약분해및혈압저하유도 ( 개발기 간 :2014. 09. ~ 2017. 09.) 과제의최종보고서로제출합니다. 2017. 11.. 주관연구기관명 : 서울시립대학교산학협력단

More information

석사논문.PDF

석사논문.PDF ABO Rh A study on the importance of ABO and Rh blood groups information in Public Health 2000 2 1 ABO Rh A study on the importance of ABO and Rh blood groups information in Public Health 2000 2 2 ABO Rh

More information

Very low-risk Low-risk Intermediate-risk High-risk Appendiceal mucinous tumours Mucinous adenoma Mucinou

Very low-risk Low-risk Intermediate-risk High-risk Appendiceal mucinous tumours Mucinous adenoma Mucinou I. Workshop 결과에대한설문조사결과 A. 종양의행태 (behavior) 코드부여에이견이있는소화기계암에대한설문조사결과 Organ or Subject Stomach Colon Diagnosis 응답자수 ( 총 240 명 ) Low grade adenoma/dysplasia 230 10 0 1 2 3 6 무응답 High grade adenoma/dysplasia

More information

untitled

untitled 3. 농업환경연구과 과제구분 기본연구 수행시기 전반기 연구과제 및 세부과제 수행 기간 소 속 책임자 농가에 적합한 부식성곤충 대량 사육기술 개발 12~ 13 농업환경연구과 곤충팀 이영혜 1) 부식성 곤충 먹이 제조 기술 개발 12~ 13 농업환경연구과 곤충팀 이영혜 색인용어 부식성곤충, 장수풍뎅이, 계통, 먹이제조 ABSTRACT In first check,

More information

Kbcs002.hwp

Kbcs002.hwp Does Real-time Compound Imaging Improve Evaluation of reast Cancer Compared to Conventional Sonography? o Kyoung Seo, M.D., Yu Whan Oh, M.D., Kyu Ran Cho, M.D., Young Hen Lee, M.D., Hyung Joon Noh, M.D.,

More information

Chapter 26

Chapter 26 11 주 RNA 합성 11.1 DNA-dependent synthesis of RNA: Bacteria에서의 transcription l RNA polymerase (5 subunits로구성 : 2α, β, β, σ) l 효소에의한 RNA 합성의특징 - Complementary sequence to template DNA - RNA chain의합성방향 : 5

More information

.,,,,,,.,,,,.,,,,,, (, 2011)..,,, (, 2009)., (, 2000;, 1993;,,, 1994;, 1995), () 65, 4 51, (,, ). 33, 4 30, (, 201

.,,,,,,.,,,,.,,,,,, (, 2011)..,,, (, 2009)., (, 2000;, 1993;,,, 1994;, 1995), () 65, 4 51, (,, ). 33, 4 30, (, 201 4 21.,,,.,,. 1, 2, 3, 4.,,,,,,.,,,,., ( ). 60-66,,,,,.. (Corresponding Author): / / 303 Tel: 063-220-2495/ E-mail: ikkim@jj.ac.kr .,,,,,,.,,,,.,,,,,, (, 2011)..,,, (, 2009)., (, 2000;, 1993;,,, 1994;,

More information

45-51 ¹Ú¼ø¸¸

45-51 ¹Ú¼ø¸¸ A Study on the Automation of Classification of Volume Reconstruction for CT Images S.M. Park 1, I.S. Hong 2, D.S. Kim 1, D.Y. Kim 1 1 Dept. of Biomedical Engineering, Yonsei University, 2 Dept. of Radiology,

More information

1. Korea Centers for Disease Control and Prevention. The fifth Korea National Health and Nutrition Examination Survey (KNHANES V-1) 2010. Cheongwon: Korea Centers for Disease Control and Prevention; 2012.

More information

Crt114( ).hwp

Crt114( ).hwp cdna Microarray Experiment: Design Issues in Early Stage and the Need of Normalization Byung Soo Kim, Ph.D. 1, Sunho Lee, Ph.D. 2, Sun Young Rha, M.D., Ph.D. 3,4 and Hyun Cheol Chung, M.D., Ph.D. 3,4 1

More information

09È«¼®¿µ 5~152s

09È«¼®¿µ5~152s Korean Journal of Remote Sensing, Vol.23, No.2, 2007, pp.45~52 Measurement of Backscattering Coefficients of Rice Canopy Using a Ground Polarimetric Scatterometer System Suk-Young Hong*, Jin-Young Hong**,

More information

232 도시행정학보 제25집 제4호 I. 서 론 1. 연구의 배경 및 목적 사회가 다원화될수록 다양성과 복합성의 요소는 증가하게 된다. 도시의 발달은 사회의 다원 화와 밀접하게 관련되어 있기 때문에 현대화된 도시는 경제, 사회, 정치 등이 복합적으로 연 계되어 있어 특

232 도시행정학보 제25집 제4호 I. 서 론 1. 연구의 배경 및 목적 사회가 다원화될수록 다양성과 복합성의 요소는 증가하게 된다. 도시의 발달은 사회의 다원 화와 밀접하게 관련되어 있기 때문에 현대화된 도시는 경제, 사회, 정치 등이 복합적으로 연 계되어 있어 특 한국도시행정학회 도시행정학보 제25집 제4호 2012. 12 : pp.231~251 생활지향형 요소의 근린주거공간 분포특성 연구: 경기도 시 군을 중심으로* Spatial Distribution of Daily Life-Oriented Features in the Neighborhood: Focused on Municipalities of Gyeonggi Province

More information

A 617

A 617 Special Issue Diabetic Retinopathy Won Ki Lee, M.D. Department of Ophthalmology The Catholic University of Korea College of Medicine Kangnam St. Mary s Hospital E mail : wklee@catholic.ac.kr Abstract R

More information

서강대학교 기초과학연구소대학중점연구소 심포지엄기초과학연구소

서강대학교 기초과학연구소대학중점연구소 심포지엄기초과학연구소 2012 년도기초과학연구소 대학중점연구소심포지엄 마이크로파센서를이용한 혈당측정연구 일시 : 2012 년 3 월 20 일 ( 화 ) 14:00~17:30 장소 : 서강대학교과학관 1010 호 주최 : 서강대학교기초과학연구소 Contents Program of Symposium 2 Non-invasive in vitro sensing of D-glucose in

More information

뉴스지14호-칼라

뉴스지14호-칼라 2 3 4 5 6 TaKaRa Taq TM / TaKaRa Ex Taq TM / TaKaRa LA Taq TM / Pyrobest TM DNA Polymerase/ TaKaRa Z -Taq TM TaKaRa Taq TM TaKaRa Ex Taq TM TaKaRa LA Taq TM TaKaRa Z-Taq TM Pyrobest TM DNA Polymerase 7

More information

untitled

untitled DOI: 10.3857/JKSTRO.2008.26.2.113 노령의 피부암에서 방사선치료 계명대학교 의과대학 동산의료원 방사선종양학교실 김 진 희 목 적: 노령의 피부암에서 방사선치료 후 국소 제어률, 생존율, 실패양상, 부작용을 알아보기 위해 이 연구를 시행 하였다. 대상 및 방법: 1990년 1월부터 2002년 10월까지 계명대학교 동산의료원 방사선종양학과에서

More information

KISEP Rhinology Korean J Otolaryngol 2000;43:391-5 소아만성부비동염의원인균분석 최영철 김태철 전은주 박용수 Microbiologic Study of Chronic Sinusitis in Children Young-Chul Choi

KISEP Rhinology Korean J Otolaryngol 2000;43:391-5 소아만성부비동염의원인균분석 최영철 김태철 전은주 박용수 Microbiologic Study of Chronic Sinusitis in Children Young-Chul Choi KISEP Rhinology Korean J Otolaryngol 2000;43:391-5 소아만성부비동염의원인균분석 최영철 김태철 전은주 박용수 Microbiologic Study of Chronic Sinusitis in Children Young-Chul Choi, MD, Tae-Chul Kim, MD, Eun-Ju Jeon, MD and Yong-Soo

More information

45(3)-10(048)p fm

45(3)-10(048)p fm The Korean Journal of Microbiology, Vol. 45, No. 3, September 009, p. 86-90 Copyright 009, The Microbiological Society of Korea s Semi-quantitative RT-PCR w v H9N y» ù» 1 Á Á 3 Á 4 Á x 5 Á 5 Á 5 Á 5 Á«x

More information

제 9 도는 6제어항목의 세팅목표의 보기가 표시된 레이더 챠트(radar chart). 제 10 도는 제 6 도의 함수블럭(1C)에서 사용되는 각종 개성화 함수의 보기를 표시하는 테이블. 제 11a 도 제 11c 도까지는 각종 조건에 따라 제공되는 개성화함수의 변화의

제 9 도는 6제어항목의 세팅목표의 보기가 표시된 레이더 챠트(radar chart). 제 10 도는 제 6 도의 함수블럭(1C)에서 사용되는 각종 개성화 함수의 보기를 표시하는 테이블. 제 11a 도 제 11c 도까지는 각종 조건에 따라 제공되는 개성화함수의 변화의 (19) 대한민국특허청(KR) (12) 특허공보(B1) (51) Int. Cl. 5 B66B 1/18 (45) 공고일자 1993년09월28일 (11) 공고번호 특1993-0009339 (21) 출원번호 특1989-0002580 (65) 공개번호 특1989-0014358 (22) 출원일자 1989년03월02일 (43) 공개일자 1989년10월23일 (30) 우선권주장

More information

발간등록번호 11-1470550-000330-01 식품중사용원료진위판별지침서 유전자분석법활용 2013. 12. - 유전자분석법활용 - 발간사 최근부당이익을얻기위하여값싼원료를사용하거나표시사항을허위로기재하는등의불량식품 가짜식품 제조 유통사례가증가하고있는실정입니다. 특히고추양념을혼합한불량고춧가루 다진마늘에양파혼합 홍삼분말에마분말혼합등의사례가언론등을통하여보도되면서식품에대한불안감이있는실정입니다.

More information

서론 34 2

서론 34 2 34 2 Journal of the Korean Society of Health Information and Health Statistics Volume 34, Number 2, 2009, pp. 165 176 165 진은희 A Study on Health related Action Rates of Dietary Guidelines and Pattern of

More information

DBPIA-NURIMEDIA

DBPIA-NURIMEDIA The e-business Studies Volume 17, Number 6, December, 30, 2016:237~251 Received: 2016/11/20, Accepted: 2016/12/24 Revised: 2016/12/21, Published: 2016/12/30 [ABSTRACT] Recently, there is an increasing

More information

환경중잔류의약물질대사체분석방법확립에 관한연구 (Ⅱ) - 테트라사이클린계항생제 - 환경건강연구부화학물질연구과,,,,,, Ⅱ 2010

환경중잔류의약물질대사체분석방법확립에 관한연구 (Ⅱ) - 테트라사이클린계항생제 - 환경건강연구부화학물질연구과,,,,,, Ⅱ 2010 11-1480523-000702-01 환경중잔류의약물질대사체분석방법확립에 관한연구 (Ⅱ) - 테트라사이클린계항생제 - 환경건강연구부화학물질연구과,,,,,, Ⅱ 2010 목차 ⅰ ⅱ ⅲ Abstract ⅳ Ⅰ Ⅱ i 목차 Ⅲ Ⅳ i 목차 ii 목차 iii Abstract α β α β iv Ⅰ. 서론 Ⅰ 1 Ⅱ. 연구내용및방법 Ⅱ. 2 Ⅱ. 연구내용및방법

More information

Wnt and other signalings

Wnt and other signalings Wnt and other signalings 발생은진화적으로하등동물부터인간까지보전되어있는여러가지 signaling에의해적절한때, 적절한장소에서이들의 target genes의발현을통하여조절되어지는것으로알려져있다. 대표적으로발생동안에중요하다고알려진신호로는 Wnt singaling과 TGF-βs, activins 그리고 BMPs와같이크게세가지 families로나뉠수있는

More information

Table 1. Distribution by site and stage of laryngeal cancer Supraglottic Glottic Transglottic Total Stage Total 20

Table 1. Distribution by site and stage of laryngeal cancer Supraglottic Glottic Transglottic Total Stage Total 20 KISEP Head and Neck Korean J Otolaryngol 1999;42:1284-9 후두암수술환자에대한치료성적 송달원 김희준 정현수 김영한 안재현 이복수 박선호 Treatment Result in Laryngeal Cancer Patients Submitted to Surgical Treatment Dal Won Song, MD, Hee Jun

More information

550호(01-09)

550호(01-09) T H E K O R E A N D O C T O R S W E E K L Y www.docdocdoc.co.kr I N S I D E 38 3 5 6 8 11 13 24 25 27 29 31 38 41 42 2 Advertisement Government & Medicine 3 Government & Medicine 4 Government & Medicine

More information

untitled

untitled 대한수혈학회지:제권 제호, 0 한 대학병원의 혈액 폐기 분석 김병철ㆍ서영익ㆍ채금란ㆍ신정원ㆍ최태윤 = Abstract = 순천향대학교 의과대학 서울병원 진단검사의학교실 Analysis of Discarded Blood Components at a University Hospital in Korea Byung Chul Kim, Young Ik Seo, Gum Ran

More information

제 출 문 경상북도 경산시 농업기술센터 귀하 본 보고서를 6차산업수익모델시범사업 농산물가공품개발 연구용역 과제의 최종보고서로 제출합니다. 2014 년 11 월 19 일 주관연구기관명 : 영남대학교 총괄연구책임자 : 한 기 동 연 구 원 : 김 상 욱 이 수 형 이 상

제 출 문 경상북도 경산시 농업기술센터 귀하 본 보고서를 6차산업수익모델시범사업 농산물가공품개발 연구용역 과제의 최종보고서로 제출합니다. 2014 년 11 월 19 일 주관연구기관명 : 영남대학교 총괄연구책임자 : 한 기 동 연 구 원 : 김 상 욱 이 수 형 이 상 6차 산업 수익모델 시범사업 농산물가공품개발 연구용역 최 종 보 고 서 영남대학교 식품공학과 연구책임자 : 한 기 동 제 출 문 경상북도 경산시 농업기술센터 귀하 본 보고서를 6차산업수익모델시범사업 농산물가공품개발 연구용역 과제의 최종보고서로 제출합니다. 2014 년 11 월 19 일 주관연구기관명 : 영남대학교 총괄연구책임자 : 한 기 동 연 구 원 : 김

More information

김도희_HT protein expression 표준 보고서_v1.5

김도희_HT protein expression 표준 보고서_v1.5 Production of Recombinant Proteins For Further Information, Please Contact Neurogenex Co., Ltd. Biotechnology Incubating Center "Golden Helix" Seoul Natl' Univ. Seoul 151-744, Korea TEL 82-2-875-8998 FAX

More information

이 발명을 지원한 국가연구개발사업 과제고유번호 KGM2420913 부처명 교육과학기술부 연구관리전문기관 연구사업명 전북분원운영사업 연구과제명 저탄소 녹생성장을 위한 바이오매스/에너지 개발 주관기관 한국생명공학연구원 연구기간 2009년 01월 01일 ~ 2009년 12월

이 발명을 지원한 국가연구개발사업 과제고유번호 KGM2420913 부처명 교육과학기술부 연구관리전문기관 연구사업명 전북분원운영사업 연구과제명 저탄소 녹생성장을 위한 바이오매스/에너지 개발 주관기관 한국생명공학연구원 연구기간 2009년 01월 01일 ~ 2009년 12월 (19) 대한민국특허청(KR) (12) 등록특허공보(B1) (45) 공고일자 2015년04월10일 (11) 등록번호 10-1509796 (24) 등록일자 2015년04월01일 (51) 국제특허분류(Int. Cl.) A61K 36/45 (2006.01) A23L 1/30 (2006.01) A61P 3/04 (2006.01) (21) 출원번호 10-2009-0108173

More information

untitled

untitled 대한마취과학회지 2008; 55: 190~6 Korean J Anesthesiol Vol. 55, No. 2, August, 2008 임상연구 대한민국의 마취통증의학 임상실습 현황 연세대학교 의과대학 마취통증의학교실 및 마취통증의학연구소 장동진ㆍ안소운ㆍ안지원ㆍ김종훈 The current status of anesthesiology clerkship in Korea

More information

A 0 D5-a (XQD Card Type) D5-b (CF Card Type)

A 0 D5-a (XQD Card Type) D5-b (CF Card Type) Kr http://downloadcenter.nikonimglib.com/ A 0 D5-a (XQD Card Type) D5-b (CF Card Type) D A 0 i 0 0 0 0 0 0 0 0 0 ii A http://downloadcenter.nikonimglib.com/ http://downloadcenter.nikonimglib.com/ iii i

More information

<C7D1B1B9B1A4B0EDC8ABBAB8C7D0BAB85F31302D31C8A35F32C2F75F303132392E687770>

<C7D1B1B9B1A4B0EDC8ABBAB8C7D0BAB85F31302D31C8A35F32C2F75F303132392E687770> 버스 외부 광고의 효과에 관한 탐색적 연구 : 매체 접촉률과 인지적 반응을 중심으로 1) 고한준 국민대학교 언론정보학부 조교수 노봉조 벅스컴애드 대표 이사 최근 몇 년 사이 옥외 광고나 인터넷 광고 등 BTL(Below the Line) 매체가 광고 시장에서 차지하 는 비중이 점점 높아지고 있다. 버스 외부 광고는 2004년 7월 서울시 교통체계개편 이후 이용자

More information

대한한의학원전학회지24권6호-전체최종.hwp

대한한의학원전학회지24권6호-전체최종.hwp 小兒藥證直訣 의 五臟辨證에 대한 小考 - 病證과 處方을 중심으로 1 2 慶熙大學校大學校 韓醫學科大學 原典學敎室 ㆍ 韓醫學古典硏究所 白裕相1,2*1)2) A study on The Diagnosis and Treatment Using The Theory of Five Organs in Soayakjeungjikgyeol(小兒藥證直訣) 1 Dept. of Oriental

More information

EMT

EMT Wnt and EMT Metastasis site에서암세포의전파와성장. Primary tumor보다 metastasis가대부분 cancer에의한죽음에관련있다. 이죽음을막기위해선전이된질병에대한치료개발이요구된다. Metastasis는혈류와다른 factor에의해암세포가특정기관으로전달되는것을시작으로그새로운기관에서는암세포의 interaction을통해다시성장한다. 이새로운곳에전이된세포의성장을막는것이암치료에있어목표이다.

More information

(Exposure) Exposure (Exposure Assesment) EMF Unknown to mechanism Health Effect (Effect) Unknown to mechanism Behavior pattern (Micro- Environment) Re

(Exposure) Exposure (Exposure Assesment) EMF Unknown to mechanism Health Effect (Effect) Unknown to mechanism Behavior pattern (Micro- Environment) Re EMF Health Effect 2003 10 20 21-29 2-10 - - ( ) area spot measurement - - 1 (Exposure) Exposure (Exposure Assesment) EMF Unknown to mechanism Health Effect (Effect) Unknown to mechanism Behavior pattern

More information

<BFA9BAD02DB0A1BBF3B1A4B0ED28C0CCBCF6B9FC2920B3BBC1F62E706466>

<BFA9BAD02DB0A1BBF3B1A4B0ED28C0CCBCF6B9FC2920B3BBC1F62E706466> 001 002 003 004 005 006 008 009 010 011 2010 013 I II III 014 IV V 2010 015 016 017 018 I. 019 020 021 022 023 024 025 026 027 028 029 030 031 032 033 034 035 036 037 038 039 040 III. 041 042 III. 043

More information

아태연구(송석원)13-2-05.hwp

아태연구(송석원)13-2-05.hwp 아태연구 제 13권 제 2호 2006년 11월 30일 pp.81~103 일본에서의 한국학연구 - 회고와 전망 宋 錫 源 경희대학교 사회과학부 정치외교학과 조교수 Ⅰ. 머리말 Ⅱ. 1945년 이전의 한국연구 Ⅲ. 1945년 이후의 한국연구 < 목 차 > Ⅳ. 맺음말 참고문헌 Abstract Key words(중심용어): 한국학(Korean studies), 식민지지배(colonial

More information

<35335FBCDBC7D1C1A42DB8E2B8AEBDBAC5CDC0C720C0FCB1E2C0FB20C6AFBCBA20BAD0BCAE2E687770>

<35335FBCDBC7D1C1A42DB8E2B8AEBDBAC5CDC0C720C0FCB1E2C0FB20C6AFBCBA20BAD0BCAE2E687770> Journal of the Korea Academia-Industrial cooperation Society Vol. 15, No. 2 pp. 1051-1058, 2014 http://dx.doi.org/10.5762/kais.2014.15.2.1051 멤리스터의 전기적 특성 분석을 위한 PSPICE 회로 해석 김부강 1, 박호종 2, 박용수 3, 송한정 1*

More information

ECG & EP CASES Young-Keun On, MD, PhD Division of Cardiology, Department of Medicine Cardiac & Vascular Center, Samsung Medical Center Sungkyunkwan University School of Medicine, Seoul, Korea A case of

More information

국립국어원 2011-01-28 발간 등록 번호 11-1371028-000350-01 신문과 방송의 언어 사용 실태 조사 연구 책임자: 남영신 국립국어원 2011-01-28 발간 등록 번호 11-1371028-000350-01 신문과 방송의 언어 사용 실태 조사 연구 책임자: 남영신 2011. 11. 16. 제 출 문 국립국어원장 귀하 2011년 신문과 방송의

More information

(49-54)Kjhps004.hwp

(49-54)Kjhps004.hwp Biliary Cystadenoma and Cystadenocarcinoma of the Liver Jae Hoon Lee, M.D., Dong Ho Choi, M.D. 1, Kyeong Geun Lee, M.D., Hwon Kyum Park M.D. and Kwang Soo Lee, M.D. Department of Surgery, College of Medicine,

More information

<BCF6BDC3323030392D31385FB0EDBCD3B5B5B7CEC8DEB0D4C5B8BFEEB5B5C0D4B1B8BBF3BFACB1B85FB1C7BFB5C0CE2E687770>

<BCF6BDC3323030392D31385FB0EDBCD3B5B5B7CEC8DEB0D4C5B8BFEEB5B5C0D4B1B8BBF3BFACB1B85FB1C7BFB5C0CE2E687770> ... 수시연구 2009-18.. 고속도로 휴게타운 도입구상 연구 A Study on the Concept of Service Town at the Expressway Service Area... 권영인 임재경 이창운... 서 문 우리나라는 경제성장과 함께 도시화가 지속적으로 진행되어 지방 지역의 인구감소와 경기의 침체가 계속되고 있습니다. 정부의 다각 적인

More information

<313630313032C6AFC1FD28B1C7C7F5C1DF292E687770>

<313630313032C6AFC1FD28B1C7C7F5C1DF292E687770> 양성자가속기연구센터 양성자가속기 개발 및 운영현황 DOI: 10.3938/PhiT.25.001 권혁중 김한성 Development and Operational Status of the Proton Linear Accelerator at the KOMAC Hyeok-Jung KWON and Han-Sung KIM A 100-MeV proton linear accelerator

More information

레이아웃 1

레이아웃 1 대한위장관기질종양연구회 01 GIST 06 02 11 03 Imatinib 14 04 05 06 07 Sunitinib 32 40 44 48 GIST 6 01 7 GIST Guide book GIST 8 01 9 GIST Guide book GIST (CT) MRI FDG-PET 10 02 11 GIST Guide book 12 02 (Imatinib)

More information

<31335FB1C7B0E6C7CABFDC2E687770>

<31335FB1C7B0E6C7CABFDC2E687770> 에너지기후변화교육 4(2):203~211(2014) 203 초등학교 교과서 에너지 단원의 탐구활동과 시각자료 기능 분석 사례 연구 신명경 권경필 * 경인교육대학교 Abstract : This study aimed to analyze energy related inquiry activity and visual materials in elementary textbook.

More information

<353420B1C7B9CCB6F52DC1F5B0ADC7F6BDC7C0BB20C0CCBFEBC7D120BEC6B5BFB1B3C0B0C7C1B7CEB1D7B7A52E687770>

<353420B1C7B9CCB6F52DC1F5B0ADC7F6BDC7C0BB20C0CCBFEBC7D120BEC6B5BFB1B3C0B0C7C1B7CEB1D7B7A52E687770> Journal of the Korea Academia-Industrial cooperation Society Vol. 13, No. 2 pp. 866-871, 2012 http://dx.doi.org/10.5762/kais.2012.13.2.866 증강현실을 이용한 아동교육프로그램 모델제안 권미란 1*, 김정일 2 1 나사렛대학교 아동학과, 2 한세대학교 e-비즈니스학과

More information

ºÎÁ¤¸ÆV10N³»Áö

ºÎÁ¤¸ÆV10N³»Áö case of brugada syndrome presented as chest pain STRCT rugada syndrome was described in 1992 as a new clinical entity characterized by electrocardiographic STsegment elevation in the right precordial leads

More information

( ) Ir29.hwp

( ) Ir29.hwp ORIGINAL ARTICLE Intest Res 2007;5(2):144-150 대장선종과대장암에서기질단백분해효소의발현 : MT1-MMP 및 TIMP-2 에대하여 이화여자대학교의학전문대학원내과학교실, 의과학연구소 *, 단국대학교의과대학내과학교실 신정은 ㆍ정성애ㆍ김성은ㆍ주양희 * ㆍ심기남ㆍ김태헌ㆍ유권ㆍ문일환 Expression of Matrix Metalloproteinase

More information

03이경미(237~248)ok

03이경미(237~248)ok The recent (2001-2010) changes on temperature and precipitation related to normals (1971-2000) in Korea* Kyoungmi Lee** Hee-Jeong Baek*** ChunHo Cho**** Won-Tae Kwon*****. 61 (1971~2000) 10 (2001~2010).

More information

20(53?)_???_O2O(Online to Offline)??? ???? ??.hwp

20(53?)_???_O2O(Online to Offline)??? ???? ??.hwp O2O(Online to Offline)서비스 전략방향 연구 - 모바일 사용자 경험 디자인(UX Design)을 중심으로 - O2O(Online to Offline) Service Strategy Research -Focusing on Mobile UX Design- 주저자 김 형 모 Kim, Hyung-mo BK21플러스 다빈치 창의융합인재양성사업단 BK21Plus

More information

(박경운).hwp

(박경운).hwp 임상검사와정도관리 : 제 30 권제 2 호 2008 J Lab Med Qual Assur 2008 ; 30:285-90 285 B 형간염바이러스의라미부딘치료에따른약제내성돌연변이검출 : 직접염기서열분석법과 CLIP 염기서열분석법 박현웅 1 권혜린 2 송상훈 1,2 박경운 1,2 송정한 1,2 박성섭 1 김의종 1 서울대학교의과대학검사의학교실 1, 분당서울대학교병원진단검사의학과

More information

이형석외

이형석외 KISEP Head and Neck Korean J Otolaryngol 2004;47:1146-50 성문암종에서수직부분후두절제술 한양대학교의과대학이비인후과학교실 이형석 김기태 민현정 박철원 태경 Vertical Partial Laryngectomy in Glottic Cancer Hyung Seok Lee, MD, Ki Tae Kim, MD, Hyun Jung

More information

KISEP Otology Korean J Otolaryngol 2001;44: 유전성난청과동반된 GJB2 유전자변이의세포간극에대한기능적연구 정연훈 유상준 이준호 박홍준 Functional Study of Gap Junction in GJB2 Mutations

KISEP Otology Korean J Otolaryngol 2001;44: 유전성난청과동반된 GJB2 유전자변이의세포간극에대한기능적연구 정연훈 유상준 이준호 박홍준 Functional Study of Gap Junction in GJB2 Mutations KISEP Otology Korean J Otolaryngol 2001;44:239-45 유전성난청과동반된 GJB2 유전자변이의세포간극에대한기능적연구 정연훈 유상준 이준호 박홍준 Functional Study of Gap Junction in GJB2 Mutations Associated with Hereditary Hearing Loss Yun Hoon Choung,

More information

<283732372D3733312920B4D9C3CAC1A120BCD2C7C1C6AEC4DCC5C3C6AEB7BBC1EEC0C720B3EBBEC8C0C720BDC3B7C2BAB8C1A4BFA120B4EBC7D120C0AFBFEBBCBA20C6F2B0A1283035292E687770>

<283732372D3733312920B4D9C3CAC1A120BCD2C7C1C6AEC4DCC5C3C6AEB7BBC1EEC0C720B3EBBEC8C0C720BDC3B7C2BAB8C1A4BFA120B4EBC7D120C0AFBFEBBCBA20C6F2B0A1283035292E687770> 대한안과학회지 제 49 권 제 5 호 2008 J Korean Ophthalmol Soc 49(5):727-731, 2008 DOI : 10.3341/jkos.2008.49.5.727 다초점 소프트콘택트렌즈의 노안의 시력보정에 대한 유용성 평가 김현경 1 김효명 2 정성근 1 가톨릭대학교 의과대학 성모병원 안과학교실 1, 고려대학교 의과대학 안암병원 안과학교실

More information

DBPIA-NURIMEDIA

DBPIA-NURIMEDIA 김진주 김수연. 초등학생대상장애이해교육에활용된동화에나타난장애인관분석. 특수교육, 2013, 제12권, 제2호, 135-160... 20.,,. 4.,,.,..... 주제어 : 장애이해교육, 동화, 장애인관 1. ( 1 ) Incheon Munhak Elementary School ( )(, E-mail: sooyoun@ginue.ac.kr) Dept. of

More information

발간사 반구대 암각화는 고래잡이 배와 어부, 사냥하는 광경, 다양한 수륙동물 등 약 300여점의 그림이 바위면에 새겨져 있는 세계적 암각화입니다. 오랜 기간 새겨진 그림들 가운데 고래를 잡는 배와 어부모습은 전 세계적으로 유례를 찾기 힘들 정도로 그 중요성과 가치가 큽

발간사 반구대 암각화는 고래잡이 배와 어부, 사냥하는 광경, 다양한 수륙동물 등 약 300여점의 그림이 바위면에 새겨져 있는 세계적 암각화입니다. 오랜 기간 새겨진 그림들 가운데 고래를 잡는 배와 어부모습은 전 세계적으로 유례를 찾기 힘들 정도로 그 중요성과 가치가 큽 울주 대곡리 반구대 암각화 발굴조사보고서 BANGUDAE PETROGLYPH IN DAEGOK-RI, ULJOO EXCAVATION 발간사 반구대 암각화는 고래잡이 배와 어부, 사냥하는 광경, 다양한 수륙동물 등 약 300여점의 그림이 바위면에 새겨져 있는 세계적 암각화입니다. 오랜 기간 새겨진 그림들 가운데 고래를 잡는 배와 어부모습은 전 세계적으로 유례를

More information

권유진

권유진 Malignant Peripheral Nerve Sheath Tumor of the Pancreas: A Case Report Malignant peripheral nerve sheath tumor (MPNST) is rare, soft tissue, spindle cell sarcoma of an ectomesenchymal origin. MPNSTs frequently

More information

PowerPoint 프레젠테이션

PowerPoint 프레젠테이션 여성암지키미 대장암지키미 Green Cross Genome Items Internal use only, not for distribution! 1 한국인의암유병률 비호지킨림프종기타암 담낭및기타담도 췌장암 2% 2% 18% 4% 2% 전립선암 7% 유방암 8% 간암 폐암 10% 갑상선암 19% 위암 15% 대장암 13% Internal use only, not

More information

Journal of Educational Innovation Research 2018, Vol. 28, No. 3, pp DOI: NCS : * A Study on

Journal of Educational Innovation Research 2018, Vol. 28, No. 3, pp DOI:   NCS : * A Study on Journal of Educational Innovation Research 2018, Vol. 28, No. 3, pp.157-176 DOI: http://dx.doi.org/10.21024/pnuedi.28.3.201809.157 NCS : * A Study on the NCS Learning Module Problem Analysis and Effective

More information

ºÎÁ¤¸ÆÃÖÁ¾

ºÎÁ¤¸ÆÃÖÁ¾ MAIN TOPIC REVIEWS Young-Keun On, MD, PhD Division of Cardiology, Department of Medicine Cardiac & Vascular Center, Samsung Medical Center, Sungkyunkwan University School of Medicine, Seoul, Korea Catheter

More information

278 경찰학연구제 12 권제 3 호 ( 통권제 31 호 )

278 경찰학연구제 12 권제 3 호 ( 통권제 31 호 ) 여성경찰관의직업윤리의식결정요인분석 * An Analysis of Determinantal Factors Influencing Professional Ethical Standards of South Korean Police Women 신문희 ** 이영민 *** Ⅰ. 서론 Ⅱ. 이론적배경 Ⅲ. 연구방법 Ⅳ. 연구결과 Ⅴ. 결론 Ⅰ. 서론 278 경찰학연구제 12

More information

272 石 堂 論 叢 49집 기꾼이 많이 확인된 결과라 할 수 있다. 그리고 이야기의 유형이 가족 담, 도깨비담, 동물담, 지명유래담 등으로 한정되어 있음도 확인하였 다. 전국적인 광포성을 보이는 이인담이나 저승담, 지혜담 등이 많이 조사되지 않은 점도 특징이다. 아울

272 石 堂 論 叢 49집 기꾼이 많이 확인된 결과라 할 수 있다. 그리고 이야기의 유형이 가족 담, 도깨비담, 동물담, 지명유래담 등으로 한정되어 있음도 확인하였 다. 전국적인 광포성을 보이는 이인담이나 저승담, 지혜담 등이 많이 조사되지 않은 점도 특징이다. 아울 271 부산지역 구비설화 이야기꾼의 현황과 특징 정 규 식* 1) - 목 차 - Ⅰ. 서론 Ⅱ. 부산지역 구비설화 이야기꾼의 전반적 현황 1. 이야기꾼의 여성 편중성 2. 구연 자료의 민요 편중성 3. 이야기꾼의 가변적 구연력 4. 이야기 유형의 제한성 5. 이야기꾼 출생지의 비부산권 강세 Ⅲ. 부산지역 구비설화 이야기꾼의 특징 Ⅳ. 결론 개 요 본고의 목적은

More information

16(1)-3(국문)(p.40-45).fm

16(1)-3(국문)(p.40-45).fm w wz 16«1y Kor. J. Clin. Pharm., Vol. 16, No. 1. 2006 x w$btf3fqpsu'psn û w m w Department of Statistics, Chonnam National University Eunsik Park College of Natural Sciences, Chonnam National University

More information