구강편평세포암종의발생단계에따른 TGFβ1 type Ⅱ 수용체의유전자변이 연세대학교대학원 치의학과 이은하

Save this PDF as:
 WORD  PNG  TXT  JPG

Size: px
Start display at page:

Download "구강편평세포암종의발생단계에따른 TGFβ1 type Ⅱ 수용체의유전자변이 연세대학교대학원 치의학과 이은하"

Transcription

1 구강편평세포암종의발생단계에따른 TGFβ1 type Ⅱ 수용체의유전자변이 연세대학교대학원 치의학과 이은하

2 구강편평세포암종의발생단계에따른 TGFβ1 type Ⅱ 수용체의유전자변이 지도김진교수 이논문을박사학위논문으로제출함 2004 년 12 월일 연세대학교대학원 치의학과 이은하

3 이은하의치의학박사학위논문을인준함 심사위원심사위원심사위원심사위원심사위원 인인인인인 연세대학교대학원 2004 년 12 월일

4 감사의글 끝나지않을것같기만하던박사과정이어느덧끝나게되었습니다. 이제또다른시작을위해무엇인가를준비해야할것만같습니다. 이논문이완성될때까지지도해주시고이끌어주신김진교수님께감사드립니다. 세월이흘러도늘열심히살아가시는교수님께항상부끄럽지않은제자가되도록노력하겠습니다. 바쁘신일정접어두시고조언아끼지않으신육종인교수님께도감사드리고, 멀리서도논문꼼꼼히보시고수정해주신윤정훈교수님께도감사드립니다. 환자들때문에힘드신와중에도논문에관심가져주신차인호교수님께깊이감사드립니다. 제가모르는것물어보며귀찮게해도잘가르쳐주시고설명해주신이은주교수님, 정말감사드립니다. 실험에대해아무것도모르던저에게실험하는방법차근차근설명해주고문제 가생길때마다이런저런조언해준김은정선생님무지무지고마워요. 그리고구 강병리학교실모든선생님들항상따뜻하게대해주셔서감사드립니다. 실험할때, 공부할때, 힘들때항상옆에있어준나의가장친한친구이자사랑 하는남편에게무척이나고맙습니다. 끝으로실험한다고, 논문쓴다고많이놀아주지도못했는데늦은밤학교까지데리 러오고, 발표연습하라고도와준사랑하는나의아들제원아너무너무고맙고대 견스럽다. 엄마늘너에게열심히살아가는모습보여줄게 년 12 월 이은하

5 목 차 Tables & Figures 국문요약 Ⅰ. 서론 1 Ⅱ. 연구재료및방법 5 가. 연구재료 5 나. 연구방법 6 ⑴ Laser capture microdissection(lcm) 을이용한세포분리 6 ⑵ DNA 추출 7 ⑶ TβRⅡ 중합효소반응 7 ⑷ 염기서열분석 9 ⑸ TβRⅡ 돌연변이에대한단백질구조분석 9 Ⅲ. 연구결과 11 ⑴ 다단계구강암발암과정에서 TβRⅡ 돌연변이분석 1 ⑵ TβRⅡ 돌연변이에대한단백질구조분석 15 Ⅳ. 총괄및고찰 20 Ⅴ. 결론 26 참고문헌 27 영문요약 37 - i -

6 Tables and Figures Table 1. Clinical and pathologic characteristics of the samples 5 Table 2. Primer sequences for TβRⅡ PCR 8 Table 3. TβRⅡ mutations in oral squamous cell carcinomas 13 Table 4. Amino acid changes in TβRⅡ mutation 15 Table 5. Incidence of missense mutations in multistep process 15 Figure 1 Histology of the microdissected samples 6 Figure 2 The structure of TβRⅡ gene 16 Figure 3 Sequence alignment of the extracellular domains(ecd) from TβRⅡ species homologues 17 Figure 4 The structure of TβRⅡ: Normal TβRⅡ frame 18 Figure 5 The structure of TβRⅡ: codon 135 missense mutation 19 - ii -

7 국문요약 구강편평세포암종의발생단계에따른 TGFβ1 type Ⅱ 수용체의유전자변이 Transforming growth factor β(tgfβ) 와그수용체는세포의성장, 분화를조절하고 apoptosis와 motility를조절하며결합조직의 remodeling을유도하는등다양한세포에서여러역할을하고있다. 특히 TGFβ는상피세포증식의강력한억제인자중의하나이다. 대부분의악성종양이세포증식을조절하는기능이소실되어발생하기때문에암발생단계의특정시기에서 TGFβ의기능이억제되거나신호전달기능이소실되었을것으로생각된다. 따라서두경부암발생과정의어느단계에 TGFβ type Ⅱ 수용체 (TβRⅡ) 유전자의변화가일어나는지, 나타난변화가암발생과정에어떤역할을하는지규명하기위해서는각단계의세포를따로구분하여연구를진행시켜야할필요가있다. 이에저자는 18예의구강편평세포암종조직에서레이저를이용하여외과적절제의경계부위인정상, 이형성, 침윤성암종, 경부림파절전이부위세포를각각분리하여 DNA를추출하고수용체유전인자의 exon 1~7에대해중합효소반응과염기서열분석을통해 TβRⅡ 돌연변이를조사하였고, 이런돌연변이가단백질의삼차원적구조변화를일으켰는지를분석하여다음과같은결과를얻었다 예중 6예의세포학적이형성부위에서여섯유형의유전자돌연변이가관찰되었다. 이중 1예는 exon 3의 codon 135 부위에서 ATG(Met) ACG(Thr) 으로바뀐 missense mutation이었고이부위의단백질삼차원구조변화분석결과단백질의구조가변화한것을관찰하였다. 3예는 exon 4에서세유형의 missense - iii -

8 mutation 이었고이중한유형은아미노산의 hydrophobicity 가변화되었다. 나머지 2 예는 exon 5 와 exon 7 에서 silent mutation 이었다 예의구강편평세포암종중 3 예의침윤성암종부위에서세유형의돌연변이 가관찰되었다. 3 예모두 exon 4 에서관찰되었고, codon 170, codon 186, codon 205 에서 missense mutation 이었다. 3. 경부림프절전이를나타냈던 9예의편평세포암종중 3예의침윤성암종부위에서여섯유형의돌연변이가관찰되었다. 모두 exon 4에존재하는돌연변이었고, codon 170, codon 221, codon 227, codon 236, codon 238에서 missense mutation 이, codon 389에서 silent mutation이관찰되었다. 4. 구강편평세포암종 18 예중 8 예에서 exon 4 의 codon 191 에 single nucleotide polymorphism(snp) 이관찰되었다. 이상의연구결과 TβRⅡ의돌연변이는암발생과정중전암단계부터일어난것을알수있었고, 돌연변이에의해단백질의구조가변화되면서 TGFβ와의결합친화력을감소시켜세포증식을억제하지못하는결과를초래하여발암작용을촉진한것으로생각하였다. 또한 exon 4에서 44% 의높은빈도로 SNP가관찰되어이는 cancer susceptibility 증가와관련이있을것으로사료된다. 핵심되는말 : TGFβ typeⅡ 수용체, 돌연변이, 단백질구조, 편평세포암종, 다단계 암발생과정 - iv -

9 구강편평세포암종의발생단계에따른 TGFβ1 type Ⅱ 수용체의유전적변이 ( 지도김진교수 ) 연세대학교대학원치의학과 이은하 Ⅰ. 서론 악성종양은다양한원인에의해발생되며그기전의하나가암유발유전자의활성과함께암억제유전자의비활성이다 (Kelly등 1999). Transforming growth factor β(tgfβ) 는상피세포증식의강력한억제인자중의하나로 (Chu등 1999; de Castecker등 2000; Kelly등 1999) 대부분의악성종양이세포증식을조절하는기능이상실되어발생하고있기때문에암발생단계의특정시기에 TGFβ의기능이억제되거나신호전달기능의상실이일어났을것으로생각되고있다. TGFβ는 135개의아미노산으로구성된 2개의동일한사슬로이루어져있고포유류에서는 TGFβ1, TGFβ2, TGFβ3, 3가지형태가존재하며이들각각은다른유전자에서 encode되나신호전달체계는모두같은수용체를통하여이루어진다 (Chih hu등 1998; de Caestecjer등 2000). TGFβ1은가장흔히종양세포에서증가되며종양형성과정에서가장많이연구되고있다. TGFβ 신호체계는특정세포 표면수용체에의해매개된다. 따라서이 논문에서는 TGFβ 수용체에초점을맞 추어연구하고자하였다

10 TGFβ의수용체에는 typeⅠ, Ⅱ, Ⅲ(betaglycan), Ⅳ, Ⅴ등이있다. TypeⅠ, Ⅱ, Ⅲ, Ⅴ 수용체는대부분의세포에서동시에발현되며 typeⅣ는단지뇌하수체세포에서만보인다. TypeⅡ 수용체 (TβRⅡ) 는 serine/threonine kinase를갖는 75-85kDa 의막단백질로 TGFβ와직접결합하며스스로인산화된다. TypeⅠ수용체 (TβRⅠ) 는 50-60kDa로기질과직접결합하지못한다 (Wrana등 1992; Wrana등 1994; Massague등 1992). TGFβ의생물학적인효과들은일차적으로 serine/threonine kinase receptors인 TβRⅠ과 TβRⅡ의상호작용에의해일어난다. 먼저 TβRⅡ가특이기질들과결합하게되면 TβRⅠ과수용체복합체를형성하게되고 TβRⅠ이후에 Smad 단백과함께세포내로신호가전달되게되고핵안의 Smad 복합체는 DNA에결합하여특정유전자의전사를돕는다. 이러한이유로 TβRⅠ과 TβRⅡ의기능이 TGFβ 신호전달체계에있어가장중요한요인이라할수있다 (Shi등 2003; Chen등 1995; Derynck등 1986; alexandrow등 1995; Kondo등 2003). 최근많은연구에의해 TβRⅡ 유전자가암억제유전자로알려지고있다. 두경부편평세포암종을포함한여러암세포주에서 TGFβ에의한성장억제효과가감소되고 (Roberts등 1990; Fynan등 1993; Reiss등 1990), TβRⅡ 유전자변이와발현변화가 TGFβ registance와암발생에연관이있으며 (Park등 1994; Lu등 1995; Parsons등 1995; Myeroff등 1995; Markowitz등 1995; Williams등 1996) 유방암과대장암세포에서정상의 TβRⅡ cdna가암발생을감소시킨다 (Sun등 1994; Wang 등 1995). 또한두경부암, 유방암, 폐암의 30-50% 에서염색체 3p22에위치한 TβR Ⅱ 유전자소실이있다.(Mathew등 1994; Maestro등 1993). 반복서열중하나의 adenine이 insertion 또는 deletion됨으로써결국 truncated receptor 단백질합성을나타낸다. 이러한 TβRⅡ 유전자돌연변이연구는지금까지 sporadic 대장암, 위암, 난소암등다양한인체암에서발견되었다 (Grady등 1998; Shin등 2000; Sæterdal등 2001; Parsons등 1995; Lucke등 2001). 또한 genomic instability를보이는종양세포에서이수용체의돌연변이가많이존재한다 (Orimo등 1998). 난소암에서높은 수의 TβRⅠ 돌연변이가관찰되었고 (Chen 등 2001), 두경부편평세포암종에서는 TβRⅡ 단백질의발현과연관된연구보고가있고 (Muro-Cacho 등 2001; Muro - 2 -

11 -Cacho 등 1999; Paterson 등 2001) 유전자돌연변이에대한연구는 TβRⅡ 의 missense mutation(garrigue-antar 등 1995) 과 TβRⅡ gene promotor 에서의돌연 변이를조사한연구 (Seijo 등 2001) 가있다. 한편, TGFβ와그수용체는암발생과정에복합적인역할을하는것으로알려져있다. 암발생초기단계에는암억제인자로역할을하며좀더진행된단계에서는오히려암유발인자로작용한다. 이의실험적근거들로는 TGFβ 신호체계가활성화되면원발성유선암의발생이지연되고 TGFβ 신호체계에이상이있었던쥐에서는좀더이른시기에종양이형성되어암발생초기단계에는 TGFβ가암억제인자로작용한다고하였고 (Siegel등 2000), 이와는반대로쥐에서의 spontaneous lung metastasis 형성실험에서는 TGFβ 수용체활성이증가된쥐에서전이암이훨씬많은빈도로나타나암의후반기에는 TGFβ가암유발인자로작용하는것으로생각할수있다 (Sporn등 1990). 또한유방암실험에서 TGFβ를첨가한세포주는전이가활발히일어나는 (Welch등 1990) 반면 TGFβ 수용체기능을억제시킨군에서는전이능력이급격히감소하는것을관찰할수있었다 (McEarchern등 2001). In vitro에서암발생초기에나타나는 TGFβ의암억제효과는 c-myc의발현을억제 시켜 cyclin-dependent kinase inhibitor 인 p15 와 p21 의발현을유도함으로써생 기는것으로생각되고 (Chen등 2001), 유방암이나전립선암이골조직과같은특정장기로전이되는데있어서 TGFβ의역할은 TGFβ/Smad와 p38이 osteolytic factor 인 PTHrP의발현을유도함으로써암전이를증진시킨다고한다 (Kakonen등 2002; Yin등 1999). 암억제유전자로서의 TGFβ에대한연구가많이진행되고있지만아직까지는두경부구강편평세포암종과 TGFβ의연관성연구는미흡한실정이고대부분의연구는세포배양으로얻어진암세포와정상세포, 동결조직에서얻은암조직과정상조직을이용함으로써단순히정상세포와암세포사이의차이가존재하는지에대한연구에국한되어있다

12 TGFβ의기능은다양하며, 암발생과정에서의그기능이암발생의초기단계와후기단계에서역시다르다고알려져있다. 이런연구들역시주로유방암이나전립선암등에서이루어졌고두경부암에서의연구는미흡하다. 따라서두경부암의발생단계에따른 TβRⅡ의역할을규명하기위해서는각단계의세포를따로따로분리하여연구를진행시켜야할필요가있다. 이에저자는구강편평세포암종의각단계에해당하는세포를레이저를이용하여따로따로분리하여분리된세포에서 TβRⅡ 돌연변이를조사하여그돌연변이의양상및시기를알아보고, 이런돌연변이가단백질의구조변화를유도하는지를연구함으로써구강편평세포암종발생과정에서 TβRⅡ의역할을규명하고자하였다

13 Ⅱ. 연구재료및방법 가. 연구재료 이연구재료는연세대학교치과대학구강병리학교실에서진단된구강편평세포암종환자 18예의조직을대상으로하였다. 각각의임상적및병리학적특성은 Table 1에정리하였다. 수술한암종조직에대한현미경관찰을하여외과적으로절제된이형성이없는경계부위를정상조직으로간주하였다. 정상조직에서침윤성암종으로이행되는부위에서이형성유무를관찰하였다. Table 1. Clinical and pathologic characteristics of the samples Case Age/Sex Primary site Differentiation Dysplasia L/N 1 67/F Lower gingiva WD /F Tongue MD /F Lower gingiva WD /M Tongue MD /M Lower gingiva PD /M Buccal cheek MWD /M Tongue WD /M Lower gingiva WD /F Lower gingiva WD /M Tongue WD /M Lower Lip MWD /M Lower gingiva PD /F Lower gingiva PMD /M Lower gingiva MWD /M Lower gingiva MWD /M Buccal cheek MWD /M Palatal mucosa MWD /M Mouth Floor MWD + + L/N: Lymph node metastasis, M: Male, F: Female, WD: Well differentiation, MD: Moderately differentiation, PD: Poorly differentiation MWD: Moderately to well differentiation, PMD: Poorly to moderately differentiation, - 5 -

14 나. 연구방법 ⑴ Laser capture microdissection(lcm) 을이용한세포추출 Silane coated slide glass를 70% ethanol에담근후 thermoplastic membrane을슬라이드에붙이고 Fixer Gum(Marabuwerke GmbH&Co, Germany) 으로접착시킨다음통상적인방법으로파라핀에포매된조직을 4μm두께로잘라 Hematoxylin/Eosin (H/E) 염색을시행하였다. 외과적절제의경계부위에서정상세포를, 이형성부위에서이형성세포를, 침윤성암종부위에서암종세포를, 경부림프절전이부위에서전이된암세포를각각 laser capture microdissection(lcm) 장비 (Zeiss, P.A.L.M. Mikrolaser technologie Biomateria. Pacific Co.Ltd) 를이용하여 0.5ml tube의뚜껑에분리하였다 (Figure 1). a. b c Dysplastic area This region is outlined by the Following the catapult removal laser beam of the samples into collecting vial the empty spaces of dysplastic cells - 6 -

15 b. Carcinoma area This region is outlined by the Following the catapult removal laser beam of the samples into collecting vial the empty spaces of tumor cells Figure 1. Histology of the microdissected samples. dysplastic area, carcinoma area ⑵ DNA 추출 모아진각각의세포로부터 QUIAGEN DNeasy tissue kit(quiagen Germany) 를이용하여 DNA를추출하였다. 200μl의 PBS를넣고 5분간원심분리하여세포를모은후 20μl proteinase K/200μl AL buffer를넣고 70 에서 30분간처리하였다. 10mg / ml RNase 40μl를넣고실온에서 2분간처리하였다. 100% 에틸알코올 200μl를넣고섞은후위용액을 collecting tube에옮겨원심분리하여용액을버리고 500μl의 AW1 buffer로씻고 500μl의 AW2 buffer로다시한번씻은후 50μl의 AE buffer로 DNA를추출하였다. 추출된 DNA는 -20 에보관하였다. ⑶ TβRⅡ 중합효소연쇄반응 각단계의세포로부터추출한 DNA 를주형으로하여 TβRⅡ 유전자의 exon 1~7-7 -

16 을중합효소연쇄반응 (polymerase chain reaction, PCR) 을시행하였다. 각단계세포의 DNA 2μl를사용하여 PCR mixture(takara, Japan) 로반응시켰다. 효소는 pfu-dna polymerase(mb1-fermentas) 를사용하였고 dntp(takara, Japan) 를첨가하여시행하였다. Exon 1~7 중합효소연쇄반응은 94 에서 4분간둔후변성반응을 94 에서 1분간, 결합반응을 50 ~ 58 에서 1분간, 중합반응은 72 에서 1분간 30주기를반복하고마지막중합반응은 72 에서 10분간연장하여반응시키고 4 에서반응을중지시켰다. PCR의효율을높이기위해 Nested PCR 을시행하였는데처음은 outer primer를이용하고두번째반응은 inner primer를이용하였다. 사용한 primer는 table2와같다. 양성대조군으로는 GAPDH를사용하였고음성대조군은 DNA를넣지않고중합효소연쇄반응을시행하였다. 중합효소연쇄반응산물은 ethidium bromide 처리된 1% agarose gel에서전기영동하여자외선조사하여확인하였다. Table 2. Primer sequences for TβRⅡ PCR Exon 1 Exon 2 Exon 3 Exon 4 upstream Exon 4 down stream Primer name Sequence Product(bp) Outer-F TGC GCT GGG GGC TCG GTC TAT 178 Inner-F TCG GTC TAT GAC GAG CAG Inner-R GGG ACC CCA GGA AGA CCC Outer-R GAG GCG GGG ACC CCA GGA A Outer-F CAA GTT CAT TTG AAA TTG C 306 Inner-F CAG GAA TTC ATT GGC AGG CTG Inner-R TGT GTG TAC TAT GAG AAT ACA TTA TGT Outer-R TTA CAT TTA GGA GAC AGA GAT ACA Outer-F TCT CCC CTC GCT TCC AAT 241 Inner-F TCC AAT GAA TCT CTT CAC TC Inner-R CCC ACA CCC TTA AGA GAA GA Ouer-R CAG ATC TCA GGT CCC ACA Outer-F CCA ACT CCT TCT CTC CTT GTT TTG 444 Inner-F TTT CCC CAA CAG AAT ATA ACA CC Inner-R GAA AGA TCT TGA CTG CCA CTG Outer-R TCC AAG AGG CAT ACT CCT CAT AGG Outer-F AAC ACA GAG CTG CTG CCC ATT GAG CT 568 Inner-F ATT GAG CTG GAC ACC CTG GTG GGG A Outer-R CCA GGC TCA AGG TAA AGG GGA TCT AGC A - 8 -

17 Exon 5 Exon 6 Exon 7 Outer-F CAG CTA TAT TGT GAA AAG AAA AAG GCA GC 261 Inner-F GGC AGC TGG AAT TAA ATG ATG GGC Inner-R TGC TCG AAG CAA CAC ATG Outer-R TTG TAA CCC CTG GAA TAA TGC TCG Outer-F TTT CCT TTG GGC TGC ACA TG 243 Outer-R CCT AAG AGG CAA CTT GGT TGA ATC Outer-F TTG CCT TCC GCG GAG CCC ACC AAC TAC T 252 Inner-F CCA ACT CAT GGT GTC CCT TTG Inner-R TCT TTG GAC ATG CCC AGC CTG Outer-R TTT GGT GAG AGG GGC AGC CTC TTT GGA ⑷ 염기서열분석 1% agarose gel에서전기영동에서확인된 TβRⅡ exon 1~7의중합효소연쇄반응한 DNA는 gel extraction kit(promega, USA) 를이용하여정제하였다. 중합효소연쇄반응산물은 DYEnamic ET Dye Terminator(Amersham Biosciences, USA) 를사용하여 labelling 한후 GP thermal cycle(takara Bio Inc, Japan) 를이용하여 PCR cycle을시행하였고 Sephadex G50 column을이용하여정제한후 MegaBACE 1000(Amersham Biosciences, USA) 장비로자동염기서열분석을하였다. (5) TβRⅡ 돌연변이에대한단백질구조분석 구조모델링방법 (Structrure modeling method): BLAST(Basic Local Alignment Search Tool) 와 FASTA3(version 3) 를이용하여유사한염기서열을갖는다른단백질을찾은뒤이중에서 3차원구조가알려진것을확인하고자 RCSB PDB(Protein data bank) 에서검색하였다. 검색결과 1PLO(Deep등 2003), 1KTZ(Hart등 2002), 1M9Z(Boesen 등 2002) 를찾을수있었다. 이중에서 1PLO 와 1KTZ를본단백질과의 sequence alignment와구조를기반으로 insightii (BIOSYM 의 3D graphical environment for molecular modeling package) 에서해 - 9 -

18 당되는영역의본단백질의삼차원구조를 homology modeling 하였다. 그후얻어진구조에서앞의실험에서발견되었던돌연변이가발생한부위를동일하게변이시킨뒤그구조를 energy minimization시켜서예상되는구조의변화를살펴보았다. 이때에 insight II에서 DISCOVER force field를사용하였다

19 Ⅲ. 연구결과 (1) 다단계구강암발암과정에서 TβRⅡ 의돌연변이분석 18 예의구강편평세포암종환자를대상으로암발생과정단계별로 TβRⅡ coding DNA 염기서열에해당되는 exon 1~7 에대한염기서열분석결과 exon 1, 2, 6 에서 는돌연변이가관찰되지않았고 3, 4, 5, 7 에서돌연변이가일어났다. 수용체의돌연변이유형은 14 건있었다. 10 건은 missense mutation 이었고 3 건은 silent point mutation 이었으며 1 건은 single nucleotide polymorphism(snp) 로확 인되었다 (Table 3, 4). 18예의구강편평세포암종중 2예의외과적절제의경계부인정상부위에서돌연변이가관찰되었다. Exon 4의 codon 170에서 ATC(Ile) 이 ACC(Thr) 으로바뀐 missense mutation이었다. Codon 170의돌연변이가정상부위에서부터나타나는것으로보아 SNP의가능성을생각할수있는데이는 NCBI DB와다른문헌에서는찾아볼수없는변이서열이었기때문에이를확인하기위해이부위에돌연변이를보였던환자의정상림프절에서 DNA를추출하여돌연변이분석을시행하였다. 림프절에서는돌연변이가관찰되지않아 SNP가아닌것으로간주하였다. 18예의구강편평세포암종중 6예의세포이형성부위에서여섯유형의돌연변이가관찰되었다. 1예는 exon 3의 codon 135에서 ATG(Met) 이 ACG(Thr) 로바뀐 missense mutation이었고 1예는 exon 4에서나타났으며 3건이었다. 1건은 codon 170에서 ATC(Ile) 이 ACC(Thr) 으로바뀐 missense mutation, 1건은 codon 222에서 GAT(Asp) 가 GGT(Gly) 로바뀐 missense mutation, 1건은 codon 234에서 AAC(Asn) 이 GAC(Asp) 로바뀐 missense mutation이었다. 2예는각각 exon 5의

20 codon 421(ACT(Thr) TCT(Ser)) 와 exon 7 의 codon 553 (TCG(Ser) TCT(Ser)) 에서나타난 silent mutation 이었다. 침윤성암종부위에서는 3 예의돌연변이가관찰되었는데 3 예모두 exon 4 에서나 타났으며 codon 170(ATC(Ile) ACC(Thr)), codon 186(TTC(Phe) TCC(Ser)), codon 205(AAG(Lys) GAG(Glu)) 에서 missense mutation 을보였다. 경부림프절전이가있었던총 9예의구강편평세포암종조직중 3예에서여섯유형의돌연변이가관찰되었다. 3예여섯유형의돌연변이모두 exon 4에서나타났다. Codon 170 (ATC(Ile) ACC(Thr)), codon 221 (GAA(Glu) GTA(Val)), codon 238 (AAC(Asn) ATC(Ile)), codon 227(ATC(Ile) ACC(Thr)), codon 236 (AAC(Asn) GAC(Asp)) 는 missense mutation이었고 codon 389 (AAC(Asp) AAT(Asp)) 에서는 silent mutation을보였다. Exon 4 의 Codon 191(Val Ile) 돌연변이는 8 예서관찰되었다. 정상세포에서 8 건, 이형성에서 6 건, 암세포에서 8 건, 전이된부위에서 4 건이관찰되었는데문헌확인 결과 single nucleotide polymorphism(snp) 으로밝혀졌다 (Watanabe 등 2002). 각돌연변이의아미노산변화는 Table4에정리하였다. 각아미노산의변화중 6건에서아미노산의 hydrophobicity 변화가관찰되었다. Exon 3의 codon 135, exon 4 의 codon 170, 186, 227은 hydrophobic 아미노산에서 hydrophilic 아미노산으로 exon 4의 codon 221, 238은 hydrophilic 아미노산에서 hydrophobic 아미노산으로변화되었다

21 Table 3. TβRⅡ mutations in oral squamous cell carcinomas Exon 1 Exon 2 Exon 3 No Dy Ca L/N No Dy Ca L/N No Dy Ca L/N ND ND - NA ND ND ND NA NA 3 ND NA ND NA ND NA ND NA - NA - NA 4 ND NA ND ND - NA ND - - NA ND ND ND NA ND ND ND NA NA 6 ND NA ND ND ND NA ND ND - NA ND ND - NA ND ND - NA NA NA ND ND - NA NA 9 - ND [135] ND NA - ND ND NA NA ND ND ND - ND ND ND - ND - ND ND - ND ND ND NA - ND ND NA NA 14 ND NA ND ND ND NA ND ND - NA ND ND ND NA ND ND ND NA NA ND ND ND ND NA - - ND NA - ND - NA 18 ND ND ND ND ND ND ND ND Exon 4(Up stream) Exon 4(Down stream) No Dy Ca L/N No Dy Ca L/N [221]/[238] - ND ND - 2 SNP191 SNP191 SNP191 NA - ND ND NA 3 - NA - NA ND NA ND NA 4 SNP191 NA SNP191 SNP191/[227/236] ND NA ND ND 5 SNP191 SNP191 SNP191 NA ND ND ND NA 6 SNP191 NA SNP191 SNP191 ND NA ND ND 7 SNP191 SNP191 SNP191 NA ND ND - NA 8 ND - [205] NA ND ND ND NA 9 SNP191 SNP191 SNP191 SNP191 ND ND - ND 10 SNP191 SNP191 SNP191 NA - ND ND NA 11 SNP191 SNP191 SNP191 SNP191 ND ND ND ND 12 - [222]/[234] - - ND ND ND ND NA ND ND - NA 14 - NA - ND ND NA ND ND 15 [170] [170] ND NA ND ND ND NA 16 ND [170] [170]/[186] [170] - ND - [389] 17 ND ND - NA - ND ND NA 18 [170] ND [170] ND ND ND ND ND

22 No: normal, Dy: dysplasia, Ca: Carcinoma, L/N: lymph node metastasis, NA; not available, ND: not determinant, -: negative Exon 5 Exon 6 Exon 7 No Dy Ca L/N No Dy Ca L/N No Dy Ca L/N 1 - ND ND NA NA - ND - NA 3 - NA - NA - NA - NA - NA ND NA 4 - NA NA NA ND - 5 ND - ND NA NA ND ND ND NA 6 - NA NA NA ND ND NA NA ND ND - NA 8 ND - - NA NA NA ND - ND ND NA NA - - ND NA 11 ND [421] ND ND - ND 12 ND ND ND NA NA - [553] ND NA 14 - NA NA - - ND NA ND ND 15 - ND ND NA ND ND ND NA ND ND ND NA ND ND NA - ND - NA - ND ND NA ND - - ND ND ND ND

23 Tabel 4. Amino acid changes in TβRⅡ mutation Exon Codon Mutation Hydrophobicity 변화 ATG[Methionine] ACG[Threonine] o ATC[Isoleucine] ACC[Threonine] o 186 TTC[Phenylalanine] TCC[Serine] o 205 AAG[Lysine] GAG[Glutamate] 221 GAA[Glutamate] GTA[Valine] o 222 GAT[Aspartate] GGT[Glycine] 227 ATC[Isoleucine] ACC[Threonine] o 234 AAC[Asparagine] GAC[Aspartate] 236 AAC[Asparagine] GAC[Aspartate] 238 AAC[Asparagine] ATC[Isoleucine] o 389 AAC[Asparagine] AAT[Asparagine] ACT[Threonine] TCT[Serine](silent mutation) TCG[Serine] TCT[Serine](silent mutation) Hydrophobic Hydrophilic Table 5. Incidence of missense mutations in multistep process Dysplasia Carcinoma L/N Exon 3 1 Exon Exon 5 1 Exon 7 1 L/N : Lymph node metastasis (2) TβRⅡ 돌연변이에대한단백질구조분석 위의돌연변이결과를토대로 exon 3 의 codon 135(Met-to-Thr) 의 missense

24 mutation이가져오는효과를살펴보기위해서 Swissprot DataBank에서얻은수용체의세포막외측부위아미노산서열 (figure 3) 을이용하여 Clustal X program 을이용한컴퓨터모델링을실시하였다. 분석결과단백질의삼차원구조가변화하였음을알수있었다 (figure 4, 5). 이위치의 methionine이 threonine으로변화됨으로인해표면의 potential이변화되었는데 hydrophobic patch가없어졌고주변의양전하와음전하의분포가약간변화된것을관찰할수있었다. Exon 4에서나타났던 missense mutation에대해서는이부위가 transmembrane, intracellular domain이걸쳐있는부위로, 이부위의중요성에대해서는아직까지잘알려져있지않고구조또한잘알려져있지않아이유형의돌연변이에대한삼차원적구조변화분석은수행할수없었다. 그러나 exon 4의 missense mutation 중 codon 186, 221, 227, 238은아미노산 의 hydrophobicity 가변화되었다. 이는단백질의구조가변화될수있는가능성을 제시한다고볼수있다. Figure 2. The structure of TβRⅡ gene

25 htβrⅡ mtβrⅡ rtβrⅡ ptβrⅡ ctβrⅡ xtβrⅡ FPQLCKFCDVRFSTCDNQKSCMSNCSITSICEKP...QEVCVAVWRKND.ENITLETVCH LPQLCKFCDVRLSTCDNQKSCMSNCSITAICEKP...HEVCVAVWRKND.KNITLETVCH LPQLCKFCDVTLSTCDNQKSCMSNCSVTSICEKP...QEVCVAVWRKND.KNITLETVCH LPQLCKRCDVRSSTCDNQKSCLSNCSITAICEKP...QEVCVAVWRKND.ENITIETVCD LPRLCKFCDVKATTCSNQDQCKSNCNITSICEKN...NEVCAAVWRRND.ENVTLETICH RTNVCKWCDNSHPVCDG.GICLTNCSLSSYCENP...EEICVTIWKEEN.ESLQLSTRCH mactrⅡ ETQECLFFNANWERD...TNQTGVEPPCYGDKDKRRHCFATWKNISGSIEIVKQGCW htβrⅡ mtβrⅡ rtβrⅡ ptβrⅡ ctβrⅡ xtβrⅡ DPKLPYHDFILEDAASPKCIMKEKKKPGETFFMCSCSSD.ECNDNIIFSEEYN DPKLTYHGFTLEDAASPKCVMKEKKRAGETFFMCACNNE.ECNDYIIFSEEYT DPKFTYHGFTLEDATSPTCVMKEKKRAGETFFMCSCNTE.ECNDYIIFNEEYT DPKIAYHGFVLDDAASSKCIMKERKGSGETFFMCSCSSD.ECNDHIIFSEEYA DTQKRLYGHMLDDSSSEQCVMKEKKDDGGLMFMCSCTGE.ECNDVLIFSAIDP HPLLLLENFLVPNYNTSLCVMSAMPSVSGRLYTCACTEEQECNDQLIFYNQSN mactrⅡ LDD...INCYDRTDCIEKKD...SPEVYFCCCEGN.MCNEKFSYFPEME Figure 3. Sequence alignment of the extracellular domains(ecd) from T βr Ⅱ species homologues. h-human, m-mouse, r-rat, p-pig, c-chicken, x-x.lavis. The sequence of mouse ActRⅡ ECD is also aligned. Cysteine residues are shown in bold. The eight Cys residues designated by black asterisks form four disulfide bonds that are structurally conserved in htβrⅡ and mactt Ⅱ.The arrow indicates the changed amino acid in this study

26 β1 β4 c β7 β5 c M β6 β2 β8 β3 Figure 4. The Structure of TβRⅡ: Normal TβRⅡ frame. Ribbon representation of the extracellular domain structure of TβR Ⅱ. Strands are numbered in the order in which they occur in the sequence

27 Figure 5. The Structure of TβRⅡ: codon 135 missense mutation. Surface representation of charge distribution and hydrophobic patches on the extracellular domain of TβRⅡ. Hydrophobic patches are colored yellow. Positive and negative charged patches are colored blue and red, respectively. Residue M135 and M135T are labelled in circle. The circled region has been magnified to show the change of electrostatic potential

28 Ⅳ. 총괄및고찰 두경부편평세포암종은전세계적으로매년약 500,000명의환자가존재하며그치료법이점점발전되고있다고는하지만진행된암의경우예후는 5년생존율이약 40% 로매우좋지않다 (Hall SF등 2000, Landis SH등 1999). 따라서예방과조기진단, 치료방법의선택및예후평가의유용성을위해서는암발생기전에대한이해가매우중요하다. TGFβ는발암과정에서암억제와암유발두가지기능을모두가진복합적인역할을하는것으로알려져있다. TGFβ가암억제에서암유발인자로변화되었다면이는반드시 TGFβ의성장억제기능에대한반응성이상실되어야하는데 TGFβ 기질이암발생초기와후기모두에서발현되기때문에이런반응성상실은수용체의변화에의한것으로생각할수있다. TGFβ는세포막에존재하는 Ⅰ형수용체 (Tβ RⅠ) 와 Ⅱ형수용체 (TβRⅡ) 의결합으로 Smad가활성화되어핵내로신호를전달한다. 따라서 TGFβ의신호전달체계와그기능의장애는발암과정에중요한역할을한다고생각된다 (de Castecker등 2000; Kelly등 1999). TGFβ의세포성장억제효과에대한저항력이인체암발생의한원인으로알려져있으며이러한저항력을얻게되는기전의하나로 TβRⅡ유전자의돌연변이가다양한암종세포주에서알려져있다.(Wrana등 1992; Munoz-Antoniz등 1996; Maestro등 1993; Markowitz등 1995; Grady등 1999; Wang등 1995; Ionov등 1993; Thiboeau등 1993; Furuta등 1993). 식도암, 위암, 췌장암에서 TβRⅡ유전자의돌연변이와같은유전적이상이보고되어수용체이상이상피세포기원의발암과정에서중요한기전으로작용할것으로제시된바있다 (Park등 1994). 그러나위장관계의암종과는달리두경부암종에서는아직까지 TβRⅡ의돌연변이연구는많지않은상태이다. Garrigue-Antar등은두경부편평세포암종세포주를사용한 TβRⅡ돌연변이연구에서 2개의세포주에서 missense mutation을보고하였고 (Garrigue-Antar등 1995),

29 Seijo등은두경부편평세포암종조직에서 TβRⅡ 전사시작부위의돌연변이연구에서 46% 의유전적변이를보고하였다 (Seijo등 2001). 또한 Wang등은 serine/threonine kinase domain에서 21% 의점돌연변이를보고하였다. 이들돌연변이에의한 TGFβ 신호체계의이상은두가지기전으로설명된다. 첫째, 암종세포주의돌연변이가 serine/threonine kinase domain에집중되어있어돌연변이가 Smad 유전자군의인산화과정을방해함으로써암발생과정에기여하리라고추측된다. 둘째, TβRⅡ 유전자의 missense 변이가아미노산의극성변화를유발하여단백질의구조적인 folding에영향을주거나 catalytic 활성이변함으로써 TβRⅡ 을인지하는능력에장애가생겨서세포내신호전달체계에이상이생겼을것으로추정하였다. 이연구에서는 TβRⅡ의 exon 1~7에대해돌연변이분석을하였다. 다단계암발생과정의어느시기에 TβRⅡ의변화가일어나는지를알아보기위해각단계의세포를레이저를이용하여분리하여돌연변이분석을시행하였다. 구강편평세포암종 1예에서 extracellular domain인 exon 3의이형성단계에서 missense mutation 이관찰되었고이의구조적변화를알아보기위한분석에서단백질의삼차원적구조변화가초래되었다. 돌연변이가일어난것으로밝혀진 methionine 135번 residue 는선행연구에서보고되고제안된것을근거로살펴볼때 (Guimond A 등 1999, Guimond A등 2002), TβRⅡ의 extracellular domain 중에서 TGFβ ligand가결합하거나, TβRⅠ과 tertiary complex를형성할때 TβRⅠ과상호작용을하게될것으로예상되는 amino acid residue에는속하지않고, 거리상으로도멀리떨어져서 TβRⅡ의 extracellular domain structure에서안쪽에위치하고있다. Methionine 135번 residue 주변에대한구조를비교해보면비활성구조에서는그위치를단백질표면에서확인할수있게표면에들어나있으나활성화된구조에서는 TGFβ 결합에의한구조변화의과정에서 methionine 135번 residue위에위치하던 loop가옆에위치하는 beta sheet와새로운 beta sheet을형성하면서서로간의거리가가까워지면서 methionine 135번 residue를덮어버리게되어단백질표면에서확인할수없게되는변화가일어나는것을확인할수있었다. 특히 T

30 βrⅡ의 extracellular domain 구조의 flexibility를 NMR 실험을근거로살펴본선행연구 (Deep등 2003) 에의하면 TβRⅡ 의 extracellular domain 구조를잡아주고있는 cysteine amino acid residue 사이의 disulfide bond와그아미노산주변의아미노산들의 flexibilitiy가 TβRⅡ의 extracellular domain이 TGFβ 기질과결합할때중요한역할을할것으로생각된다. Methionine 135번은이러한 disulfide bond에참여하는 cysteine amino acid residue바로옆에위치하고있다. 따라서 methionine 135번 residue가 threonine으로치환된것은이 135 위치의 flexibility 에큰영향을주게될것으로생각할수있다. 이러한돌연변이가 TβRⅡ의 extracellular domain과 TGFβ 기질사이의결합친화력을감소시켜세포증식을억제하지못하는결과를초래할수있으며따라서발암작용을촉진할수있는가능성을제시한다. TGFβ와그수용체는암발생과정에복합적인역할을하는것으로알려져있다. 상피에서 dominant negative TGFβ 수용체를갖는 transgenic mouse model( ΔβRⅡ) 을이용한실험에서 ΔβRⅡ mice는태어날때부터상피과증식이나과각화증이있었다. 이는 ΔβRⅡ가 TGFβ에의한상피증식억제기능이상실되었다는것을시사한다. ΔβRⅡ mice에서발암실험을한연구에서 12-O-tetradecanolyl-phobol-3- acetate(tpa) 처리만으로도유두종이형성되었는데이런결과는 ΔβRⅡ가발암과정의초기단계에영향을미쳤을것이라는가능성을제시한다. 이렇게유도된유두종에서는다른화학적발암단계의초기에보이는 c-ras돌연변이는관찰되지않았고 (DiGiovanni 1992) DMBA-TPA나 TPA-treated ras transgenic mice (Greenhalgh등 1996) 의한유두종보다더천천히형성되었기때문에 ΔβRⅡ의암의개시효과는약한것으로생각되는데위의실험은 TβRⅡ 신호전달체계의비활성화가피부발암과정의 predisposing event로작용한다는것을시사한다고볼수있다. 이실험에서 exon 3의 codon 135의단백질의삼차원적구조변화를수반하는 missense mutation이이형성부위에서발견되었고 exon 4에서도이형성부위에서 3건의 missense mutation이관찰되었다. 특히 exon 4의 codon 170의경우외과적절제의경계부위인정상부위에서도돌연변이가관찰되고한예에서는이

31 형성부위, 침윤성암종부위, 전이된암종부위에서순차적인돌연변이가관찰되었고또다른예에서는정상부위, 이형성부위에서순차적인돌연변이가관찰되었다. 정상부위에서부터돌연변이가관찰되어 single nucleotide polymorphism(snp) 의가능성을배제할수없어문헌고찰을하였는데 NCBI DB와다른문헌에는없는돌연변이서열이었기때문에이부위의돌연변이를보였던환자의정상림프절에서 DNA를추출하여돌연변이분석결과림프절에서는돌연변이가관찰되지않았다. 따라서이돌연변이가 SNP가아닌것으로생각하였다. 이돌연변이의아미노산변화를보면 isoleucine이 threonine으로변화되었는데이는 hydrophobic 아미노산에서 hydrophilic 아미노산으로변화된것으로정확한단백질구조분석을할수없지만 hydrophobicity의변화에의해 TGFβ에대한반응성이감소될가능성을시사한다고볼수있다. 이연구의결과로볼때 TβRⅡ의돌연변이가암을유발시키는직접적인인자로작용하는지에대해서는정확한근거를제시할수는없지만구강암발암과정의초기단계에서부터나타나는현상이고기질과의결합친화력의감소로인해발암과정에작용하는것으로생각할수있다. Exon 5 와 Exon 7 에서의나타난돌연변이역시이형성단계의세포에서관찰되었 으나 silent mutation 으로발암과정에큰의미는없을것으로생각된다. Exon 4는모든단계의세포에서돌연변이가관찰되었다. 특히 codon 191의돌연변이는정상세포군에서도높은빈도로나타나문헌고찰결과 SNP으로확인되었다 (Watanabe등 2002). 유방암, 전립선암, 간암등다양한암에서 TGFβ1 polymorphism과암발생위험, 예후등과연관된연구들이진행되었다. TGFβ1의 29번째 nucleotide에서 T-to-C transition은 polymorphism의하나로 leucine을 proline으로변화시켜혈청 TGFβ1 level을증가시킨다. 이런 polymorphism은중년여성의유방암발생위험을 20% 정도증가시킨다는연구가있고또다른 polymorphism인 509위치의 C-to-T transition은유방암위험을 25% 증가시킨다는연구가보고되어있다. TβRⅠ의 polymorphism과암과의연관성에관한연구는 Knobloch등이두경부편평세포암종의 43%(13/30) 에서 polymorphism이나타났

32 다고보고한문헌이있다 (Knobloch TJ 등 2001). TβRⅡ polymorphism과암발생위험과의연관관계를연구한문헌은보고되어있지는않지만 TβRⅡ polymorphism은 osteoporotic disorder의유용한지표로사용되고있다는보고가 (Watanabe등 2002) 있고 polycythaemia vera환자에서 TβRⅡ SNP를보고한연구가있다 (Juan L등 2001). 이연구에서 codon 191의 SNP는 44% 의높은빈도로나타났으며부위별로보면정상부위에서 8예, 이형성부위에서 6예, 암종부위에서 8예, 전이된부위에서 4예가관찰되는등높은빈도로나타났다. 아직까지 TβRⅡ 의 SNP와암과의연관성에대한연구자료는없지만이연구에서 SNP가높은빈도로나타난것은 SNP가구강편평세포암종의발생위험인자로작용했을가능성을시사하는것으로생각할수있다. Exon 4는 missense mutation이구강편평세포암종의 7예에서 10건이관찰되었고발생부위도이형성에서 3건, 침윤성암종부위에서 3건, 전이된암종부위에서 6건으로다양한부위에서관찰되었다. 그러나이부위는 transmembrane, intracellular domain이걸쳐있는부위로이부위의중요성에대해서는아직까지잘알려져있지않고구조역시잘알려져있지않아이유형의돌연변이에대한삼차원적구조변화분석은수행할수없었다. SNP(codon191) 를제외한 TβRⅡ의 missense mutation은 exon3, exon4, exon5, exon7에서각각이형성부위에서부터나타났고 exon 4의경우외과적절제의경계부위인정상부위에서도돌연변이가관찰되었다. Exon 3, exon 5, exon 7의경우이형성부위에서만돌연변이가관찰되었고다른돌연변이들도산발적으로다양한부위에서관찰되었다. 그러나 exon 4의 codon 170의경우이형성, 침윤성암종, 전이된암종부위에서순차적으로돌연변이가관찰된예가있었으며정상, 이형성부위에돌연변이가순차적으로나타난예도관찰되었다. 이런돌연변이가암종부위와전이된암종부위에서순차적으로나타나지않은예가많은것은암발생과정중다양한 subclone의출현으로설명할수있을것으로사료된다. Nerlich등은 laser microdissection을이용해서후두편평세포암종에서 TβRⅡ 돌연변이를관찰

33 한실험에서한환자의암종조직에서다섯부위를따로따로분리하여돌연변이분석을시행하였는데각부위에서서로다른돌연변이가관찰되었으며나타난돌연변이의종류도모두다른유형이었다 (Nerlich AG등 2003). 이들의연구결과도역시다양한 subclone의출현으로돌연변이를가진세포군들이세포성장에유리한조건을가지면서종양세포의성장을주도한다고설명하고있다. 지금까지의결과를종합해보면 TβRⅡ돌연변이는구강암발생과정중전암단계부터나타나며이돌연변이에의해단백질의삼차원적구조가변화되면서 TGFβ와의결합친화력을감소시켜세포증식을억제하지못하는결과를초래하여발암작용을촉진시켰을가능성을시사한다고본다

34 Ⅴ. 결론 구강내에서발생하는다단계편평상피암종의발생과정에서어느시기에 TβRⅡ변화가일어나는지일어난변화가어떤의미를갖는지를규명하기위해구강편평세포암종의각단계에해당하는세포를따로따로분류하여 DNA를추출하고수용체유전인자의 exon 1~7에대해중합효소반응과염기서열분석을통해 TβRⅡ 돌연변이를조사하고이런돌연변이가단백질의어떤구조변화를일으켰는지를분석하여다음과같은결론을얻었다. 다단계암발생과정중외과적절제부위인정상과이형성부위에서부터돌연변이가관찰된것으로보아 TβRⅡ의돌연변이는암발생과정의매우초기단계에서부터일어난것을알수있었고, 돌연변이에의해단백질의삼차원구조변화가일어나고아미노산의 hydrophobicity 변화가일어나면서 TGFβ와의결합친화력을감소시켜세포증식을억제하지못하는결과를초래하여발암작용을촉진한것으로사료되었다. 또한 exon 4에서 44% 의높은빈도로 SNP가관찰되어이는 cancer susceptibility 증가와관련이있을것으로사료된다

35 참고문헌 Alexandrow MG and Moses HL : Transforming growth factor β and cell cycle regulation. Cancer Res, 55: , 1995 Amanda ET, Chan JM, Yuan JW, Balmain A and Jing M : A gain of fundction TGFβ1 polymorphism may be associated with late stage prostate cancer. Cancer Epidemiol Biomarkers Prev, 13(5): , 2004 Attisano L, Wrana JL : Mads and Smads in TGFβ signalling. Current Opinion in Cell Biology:10: : 1998 Becker I, Becker KF, Rohrl MH, Minkus G, Schutze K, Hofler H: Single-cell mutation analysis of tumors from stained histologic slides. Lab Invest: 75: :1996 Bossen CC, Radaev S, Montyka SA, Patamawenu A, Sun PD: The 1.1A crystal structure of human TGFβ type Ⅱ receptor ligand binding domain. Structure:10: :2002 Bockmuhl U, Wolf G, Schmidt S, Schwendel A, Jahnke V, Deitel M, Petersen I: Genomic alteration associated with maligancy in head and neck cancer. Head Neck:20: :1998 Chen CR, Kang Y, Massague J: Defective repression of c-myc in breast cancer cells: A loss at the core of the trasnforming growth factor beta growth

36 arrest program. Proc. Natl. Acad.Sci. USA:98: ,2001 Chen RW, Moses HL, Maruoka M, Derynck R and Kawabata M : Phosphorylation-dependent interaction of the cytoplasmic domains of the type Ⅰ and type Ⅱ transforming growth factor β receptors. J Biol Chem: 270(20): , 1995 Chen T, Triplett J, Dehner B, Hurst B, Colligan B, Pemberton J, Gragg JR, Carter JH : Transforming growth factor-β receptor typeⅠ is frequently mutate in ovarian carcinomas. Cancer Res:61: :2001 Chih hu PP, Datto MB, Wang XF: Molecular mechanisms of transforming growth factor β signaling. Endocrine Reviews:19: :1998 de Castercker MP, Piek E and Roberts AB : Role of transforming grwoth factor β signaling in cancer. J Natl Inst Cancer, 92(17): , 2000 Deep S, Walker KP 3rd, Shu Z, Hinck AP : Solution structure and backbone dynamics of th TGF-beta typeⅡ receptor extracellular domain. Biochemistry, 42(34): , 2003 Deryneck R, Jarrett JA, Chen EY and Goeddel DV : The murine transforming growth factor-β precursor. J Biol chem:261: , 1986 DiGiovanni J: Multistage carcinogenesis in mouse skin. Pharmacol Ther : 54: ,1992 Fend M, Raffeld M : Laser capture microdissection in pathology. J Clin Pathol:

37 53: :2000 Field JK, Pavelic ZP. Spandidos DA, Stambrock PJ, Junes AD, Gluckmkan JL: The role of the p53 tumor suppressor gene in squamous cell carcinoma of the head and neck. Arch. Otolaryngol.Head Neck Surg: 119: :1993 Garrigue-Antar L, Munoz-Antonia T, Antonia SJ, Gesmonde J, Velluci VF and Reiss M : Missensse mutations of the transforming growth factor β type Ⅱ receptor in human head and neck squamous carcinoma cells. Cancer Res : 55(15) : , 1995 Gluckmkan JL, Lavelic ZP, Welkoborcky HJ, Mann W, Stambrook P, Gleich L, Wilson K, Righi P, Portugal LG, McDonald J, Biddinger P, Steward Dm Gartside P: Prognostic indicators for squamous cell carcinoma of the oral cavity: a clinicopathologic correlation. Laryngoscope: 107: :1997 Grady WM, Rajput A, Myeroff L, Liu DF, Kwon KH, Willis J, Markowtiz S : Mutation of the type Ⅱ transforming growth factor-β receptor is coincident with the transformation of human colon adenomas to malignant carcinoma. Cancer Res:58: :1998 Greenhalgh DA, Wang XJ, Donehower LA, Roop DR: Paradoxical tumor inhibitory effect of p53 loss in transgenic mice expressing epidermal-targeted v-rasha, v-fos, or human tansforming growth factor alpha. Cancer Res: 56: :1996 Guimond A, Sulea T, Pepin MC, O'connor-McCourt MD: Mapping of putative binding sites on the ectodermain of the type Ⅱ TGF β receptor by scaccnin

38 g-deletion mutagenesis and knowledge-based modeling. FEBS Letters: 456:79-84:1999 Guimomd A, Sulea T, Pen A, Ear P, O'connor-McCourt MD: Site-directed mutagenesis of the type Ⅱ TGF-β receptor indicates as ligand-binding site distinct from that of the type Ⅱ activin receptor. FEBS Letters:515:13-19:2002 Guimond A, Sulea T, Zwaagstra JC, Ekiel I, O'connor-McCourt MD: Identification of a functional site on the type Ⅰ TGF-β receptor by mutational analysis of its ectodomain. FEBS Letters:513: :2002 Hall SF, Groome PA, Rothwell D: The impact of comorbidity on the survival of patients with squamous cell carcinoma of the head and neck. Head Neck:22: :1999 Hart PJ, Deep S, Taylor AB, Shu Z, Hinck CS, Hinck AP: Crystal structure of the human TβR2 ectodomain-tgf-β3 complex. Nat Struct Biol: 9(3) : :2002 Izumoto S, Arita N, Ohnishi T, Hiraga S, Taki T, Tomita N, Ohue M, Hayahawa T : Microsatellite instability and mutated type Ⅱ transforming growth factor-β receptor gene in gliomas. Cancer Letters:11: :1997 Jeremy NR, Anita JB and Xiao FW : Transformin growth factor-β signaling in cancer. Microscopy Res Tech, 52: , 2001 Juan L, Anthony J, Brian JPH, Anthony R : Mutation and methylation analysis of the transforming growth factor β receptor Ⅱ gene in polycythaemia vera

39 British J Haematol: 115: :2001 Kakonen SM, Selander KS, Chirgwin JM, Yin JJ, Burns S, Rankin WA, Grubbs BG, Dallas M, Cui Y, Guise TA : Transforming growth factor-β stimulates parathyroid hormone-related protein and osteolytic metastasis via Smad and mitogen-activated protein kinase signaling pathways. J Biol. Chem:277: :2002 Kim SJ, Im YH, Markowitz SD, Bang YJ : Molecular mechanism of inactivation of TGF-β receptors during carcinogenesis. Cytokine Growth Factor Rev :11: :2000 Knobloch TJ, Lynch MA, Song HJ, DeGroff VL, Casto BC, Adams EM, Alam KY, Land JC, Schuller DE and Weghorst CM : Analysis of TGFβ type Ⅰ receptor for mutations and polymorphism in head and neck cancers. Mutation Res: 479: , 2001 Knobloch TJ, Lynch MA, Song HJ, DeGroff VL, Casto BC, Adams EM, Alam KY, Lang JC, Schuller DE, Weghorst CM : Analysis of TGF-β type Ⅰ receptor for mutations and polymorphism in head and neck cancers. Mutation Res:479: : 2001 Kondo M, Suzuki H, Takehara K, Miyazono K and Kato M : Transforming growth factor-β signaling is differentially inhibited by Smad2D450E and Smad3D407E. Cancer Sci:95:12-17: 2004 Landis SH, Murray T, Bolden S, Wingo PA : Cancer statistics. CA Cancer J. Clin:49:8-31:

40 Lloyd RV: Laser Capture Microdissection; Principles and applications. Morphology methods :Cell and Molecular Biology Technique:11-25 Lucke CD, Philpott A, Metclfe JC, Thompson AM, Davies LH, Kemp PR, Hesketh R: Inhibiting mutations in the transforming growth factor β type 2 receptor in recurrent human breast cancer. Cancer Res:61: :2001 Massague J : Receptors for the TGF β family. Cell:69: , 1992 McEarchern JA, Kobie JJ, Mack V, Su RS, Meade-Tollin L, Arteaga CL, Dumont N, Besselsen D, Seftor E, Hendrix MJ: Invasion and metastasis of a mammary tumor involves TGF-beta signaling. Int.J. Cancer:91:76-82:2001 Mooustakas A, Pardali K. Gaal A, Heldin CH : Mechanism of TGFβ signaling in regulation of cell growth and differentiation. Immunol Letters:82:85-91, 2002 Muro-Cacho CA, Anderson M, Cordero J, Munoz-Antonia T: Expression of transforming growth factor β type Ⅱ receptors in head and neck squamous cell carcinoma. Clin Cancer Res:5: , 1999 Muro-Cacho CA, Rosario-Ortiz K, Livingston S, Munoz-Antonia T: Defective transforming growth factor β signaling pathway in head and neck squamous cell carcinoma as evidenced by the lack of expression of activated Smad2. Clin Cancer Res:7: , 2001 Nerlich AG, Sauer U, Rouss I and Hagedorn HG : High frequency of TGFβ receptor-Ⅱ mutations in microdissected tissue samples from laryngeal

41 squamous cell carcinomas. Laboratory investigation: 83(8) : , 2003 Orimo H, Ikejima M, Nakajima E, Emi M, Shimada T : A novel missense mutation and frameshift mutations in the typeⅡ receptor of transforming growth factor-β gene in sporadic colon cancer with miscrosatellite instability. Mutation Res Geno:382: :1998 Park K Kim SJ, Bang YJ, Park JG, Kim NK, Roberts AB, Sporn MB : Genetic changes in the transforming growth factor β(tgf-β) type Ⅱ receptor gene in human gastric cancer cells : Correlation with sensitivity to growth inhibition by TGF-β. Proc. Natl. Acad. Sci. USA:91: , 1994 Parsons R, Myeroff LL, Willson JKL, Markowitz SD, Kinzler KW, Vogelstein B : Mircrosatellite instability and mutations of the transforming growth factor β type Ⅱ receptor gene in colorectal cancer. Cancer Res : 55: :1995 Piffko J, Bankfalve A, Joos U, Ofner D, Krassort M, Schmid KW: Immunophenotypic analysis of normal mucosa and squamous cell carcinoma of the oral cavity. Cancer Detect Prev:23:45-56:1999 Rich JN, Borton AJ, Wang XF : Transforming growth factor-β signaling in cancer. Microscopy Res and Tech:52: :2001 Role of TGF β in oncogenesis. Microscopy Res and Tech:52:353:2001 Rooke HM, Vitas MR, Crosier PS, Crosier KE : The TGF-β type Ⅱ receptor in chronic myeloid leukemia: analysis of microsatellite regions and gene expression. Leukemia:13: :

42 Sæterdal I, Bjørheim J, Lislerud K, Gjertsen MK, Bukholm IK, Olsen OC, Nesland JM, Eriksen JA, Møller M, Lindblom A, Gaudernack G: Frameshift mutation derived peptides as tumor specific antigens in inherited and spontaneous colorectal cancer. PNAS:98: :2001 Shin KH, Park YJ and Park JG : Mutational analysis of the transforming growth factor β receptor type Ⅱ gene in hereditary nonpolyposis colorectal cancer and early-onset colorectal cancer patients. Clinical Cancer Res: 6: : 2000 Siegel PM, Shu W, Cardiff RD, Muller WJ, Massague J : Transforming growth factor β signaling impairs neu-induced mammary tumorigenesis while promoting pulmonary metastasis. Proc. Natl. Acad. Sci. USA:100: :2003 Sijo ER, Song HJ, Lynch MA, Jennings R, Qong X, Lazaridis E, Weghorst CM : Identification of genetic alterations in the TGF β type Ⅱ receptor gene promoter. Mutation Res : 483: 19-26, 2001 Sporn MB, Roberts AB : TGF-β problems and prospects. Cell Regul: 1: :1990 Wakefield LM, Robert AB : TGF-β signaling : positive and negative effects on tumorigenesis. Curr opinion in genetics & development : 12:22-29, 2002 Wang D, Song HJ, Evans JA, Lang JC, Schuller DE and Weghorst CM : Mutation and downregulation of the transforming growth factor β type Ⅱ receptor gene in primary squamous cell carcinomas of the head and neck

43 Carcinogenesis:18: : 1997 Wang D, Tatsuya K, Hideki M, Fumilo T, Yoshito I, Norio W, Akita M, Yoshimori S, Seiichi T: Analysis of specific gene mutations in the transforming growth factor-β signal transduction pathway in human ovarian cancer. Cancer Res:60: :2000 Wang XJ : Role of TGFβ signaling in skin carcinogenesis. Microscopy REs and Tech : 52: :2001 Watanabe Y, Kinoshita A, Yamada T, Ohta T, Kishino T, Mastamoto N, Ishikawa M, Miikawa N and Yoshiura KI : A tatalog of 106 single-nucleotide polymorphisms(snps) and 11 other types of variations in genes for transforming growth factor-β1(tgf-β1) and its signaling pathway. J Hum Genet: 47: , 2002 Welch DR, Rabra A, Nakajima M : Transforming growth factor β stimulates mammary adenocarcinoma cell invasion and metastatic potential. Proc. Natl. Acad. Sci. USA: 87: :1990 Wrana JL, Attisano L, Carcamo J, Zentella A, Doody J, Laiho M, Wang XF and Massague J : TGFβ signal as through a heteromeric protein kinase receptor complex. Cell: 69: , 1992 Wrana JL, Attisano L, Wieser R, Ventura F, Massague J : Mechanism of activation of the TGF-β receptor. Nature: 370: :1994 Yigong S, Joan M : Mechanisms of TGFβ signaling from cell membrane to the

44 nucleus. Cell, 113: , 2003 Yin JJ, Selander K, Chirgwin JM, Dallas M, Grubbs BG, Wieser R, Massague J, Mundy GR, Guise TA : TGF-β signaling blockade inhibits PTHrP secretion by breast cancer cells and bone metastasis development. J Clin. Invest.:103: :

45 ABSTRACT Mutation analysis of trasnforming growth factor beta type Ⅱ receptor based on multistep process of oral squamous cell carcinoma EUNHA LEE Departments of Dental Science, Graduated school, Yonsei university ( Directed by Prof. Jin Kim D.D.S., Ph. D. ) The role of transforming growth factor β (TGFβ) family members in carcinogenesis is complex. A widely accepted concept suggests that a critical step of carcinogenesis is the deregulation of TGFβ action and its signaling function. We have previously observed mutation of TGFβ type Ⅱ receptor(tβ RⅡ) gene in Oral squamous cell carcinoma(oscc) cell lines. In the present study, 18 cases of OSCC were used for genetic mutation analysis of TβRⅡ. Focused on multistep process, each area was selected by normal surgical margin, dysplastic lesion, carcinoma and metastatic cancer cells by laser captured microdissection(lcm). Exon specific spanning primers of exon 1, 2, 3, 4, 5, 6, 7 were used for PCR amplification of the genomic DNA and each of the amplified sequences were analyzed for their mutation sites. The structure of TβRⅡ ectodomain was analyzed by structure modeling method

46 The results were as follows : 1. The genetic mutations were found in 6 cases of dysplastic area. In one case, mutation was found in exon3(extracellular domain) at codon 135[Met to Thr] which induced the structural change in extracellular domain of the receptor. In 3 cases, missense mutations were found in exon4. One of them showed the alteration of hydrophobicity of amino acid. The genetic change in exon5 and exon7 was silent mutation. 2. The mutations were found in 3 cases of invasive carcinoma area. Those were located in exon 4 at codon 170, codon 186 and codon The mutation was observed in 3 cases of metastatic area within lymph node. Six kinds of mutation were found in exon4 at codon 170codon 221, codon 227,codon 236, codon 238, codon The most common site of genetic change was codon 191(Val to Ile) of exon 4 which was found in eight cases throughout normal surgical margin, dysplastic lesion, carcinoma and metastatic cancer cells. This mutation was turned out single nucleotide polymorphism(snp). These results suggest that TβRⅡ mutations occur in early stage of tumor development and TβRⅡ polymorphisms may contribute to the susceptibility for cancer development. Key words: TGFβ1 type Ⅱ receptor, mutations, multistep process, oral squamous cell carcinomas