hwp

Save this PDF as:
 WORD  PNG  TXT  JPG

Size: px
Start display at page:

Download "hwp"

Transcription

1 긴털가루진드기 (Tyrophagus putrescentiae) 의 Expressed Sequence Tags 분석및 Tyr p 13의알레르겐항원성규명 연세대학교대학원 의학과 김우경

2 긴털가루진드기 (Tyrophagus putrescentiae) 의 Expressed Sequence Tags 분석및 Tyr p 13의알레르겐항원성규명 지도김규언교수 이논문을박사학위논문으로제출함 2004년 12월일 연세대학교 대학원 의학과 김우경

3 김우경의박사학위논문을인준함 심사위원 인 심사위원 인 심사위원 인 심사위원 인 심사위원 인 연세대학교대학원 2004년 12월일

4 감사의글 본연구를시작하게해주시고끊임없는관심과학문적인지도로이끌어주신은사김규언교수님께진심으로감사를드립니다. 또한연구를진행하고논문을작성는데있어많은조언을주신기생충학교실의용태순교수님, 내과학교실의홍천수교수님, 소아과학교실의김동수교수님, 미생물학교실의이봉기교수님께감사를드립니다. 그리고연구진행에많은도움을주시고어려운실험과정에직접참여하여주신기생충학교실의정경용박사님께도깊은감사를드립니다. 하늘에서늘지켜봐주시는아버님과언제나한결같은마음으로기도와격려를아끼지않으시는어머님및가족에게감사드리며, 이논문을바칩니다. 마지막으로언제나겸손을가르쳐주신하느님께감사를돌립니다. 저자씀

5 차 국문요약 1 례 I. 서론 4 II. 재료및방법 7 1. 재료 7 가. 긴털가루진드기조항원제조 7 나. 긴털가루진드기피부시험시약제조 7 2. cdna expression library의제조 7 가. 전체 RNA 및 mrna의분리 7 나. cdna library 제작 8 다. In vivo excision 9 3. DNA sequencing 9 4. 재조합항원의발현및분리 10 가. Fatty acid binding protein 유전자의발현벡터로의 subcloning 10 나. 재조합알레르겐의발현및분리 긴털가루진드기알레르겐의특성규명 11 가. 대상환자 11 나. 알레르기항원성의재검정 11 (1) ELISA 시험 11 (2) ELISA 억제시험 12 -i-

6 다. 통계분석 12 III. 결과 Expressed sequence tags의데이터베이스의분석 긴털가루진드기의 fatty acid binding protein의상동성 대상환자의특성 소아환자의피부시험 긴털가루진드기양성환자의총 IgE 와호산구 긴털가루진드기피부시험양성결과와혈액검사의상관성 재조합 Tyr p 13의 IgE binding과발현 재조합 Tyrp13의억제시험 22 IV. 고찰 23 V. 결론 27 참고문헌 28 영문요약 34 -ii-

7 그림차례 Fig. 1. A photo of Tyrophagus putrescentiae. (100x) 6 Fig. 2. Nucleotide and deduced amino acid sequences of T. putrecsentiae fatty acid binding protein. 16 Fig. 3. A three dimensional structural model of Tyr p Fig. 4. Amino acid sequence alignment of four arthropod fatty acid binding proteins. 18 Fig. 5 Purification of the recombinant Tyr p iii -

8 Fig. 6. IgE reactivity of human sera against T. putrecsentiae. 21 Fig. 7. IgE reactivity of human sera against recombinant Tyr p Fig. 8. Inhibition ELISA of T. putrescentiae crude extract and recombinant Tyr p Fig. 9. The taxonomic position of T. putrescentiae 26 - iv -

9 표차례 Table 1. ESTs of the T. putrescentiae cdna library 13 Table 2. Significant matches of T. putrescentiae ESTs with sequences present in DNA and protein databases 13~14 Table 3. Expressed sequence tags(ests) match with allergenic clones 15 - v -

10 국문요약 긴털가루진드기 (Tyrophagus putrescentiae) 의 Expressed Sequence Tags 분석및 Tyr p 13의알레르겐항원성규명 호흡기알레르기에있어가장중요한흡입성알레르겐으로집먼지 진드기 (Dermatophagoides 속) 로밝혀져있으나, 최근긴털가루진드 기도흡입성알레르겐으로관심을끌고있다. 본연구는긴털가루진드 기의알레르겐을확인하고, 특성을규명하고자하였다. 또한본연구를 통해알레르겐의구조와항원성(allergenicity) 을연구하는데이용하고 자하였다. 긴털가루진드기의전체 RNA 및 mrna를분리하여 cdna library를 제작하였고이를이용하여 Expressed sequence tags(ests) 를분석 하였다. 이중 fatty acid binding protein과상동성이있는 Tyr p 13 의재조합항원을발현및분리하였다. 긴털가루진드기의조항원을만 들고이것으로대상환자에게피부시험을시행하여긴털가루진드기항 원에양성를보인혈청으로알레르기항원성의재검정을위한 ELISA 시험과 ELISA 억제시험을시행하였다. 총대상소아환자432명중남녀비는1.07:1의비율이었으며연령은 8±3 세이었다. 이들중에서긴털가루진드기피부시험에양성인소아환 자 54명의남녀비는 26:28였으며연령은 7±1 세였다. 또한긴털가루진 드기에양성인성인 24명의남녀비는 17:7 였으며, 연령은 27±10세였 다. 소아환자 432명에서 12개항원에대한피부시험의양성률은 D. pteronyssinus(69.5%), D. farinae(57.8%), B. germanica(34.2%), P. americana(22.3%), cat(16.3%), Alternaria(15.7%), dog(12.8%), T. putrescentiae(12.7%), Penicillium(6.0%), oak(5.3%), ragweed(4.4%), alder(4.2%) 순으로나타났다. 긴털가루진드기피부시 -1-

11 험에양성인소아와성인환자(n=78) 의피부시험결과는 1+ 가 10례 (12.8%), 2+ 가 24 례(30.7%), 3+ 가 38 례(48.7%), 4+ 가 6 례(7.7%) 였 다. 피부시험결과에서긴털가루진드기에양성을보인소아환자 54명의 총 IgE의평균은 ± IU/mL, 호산구는 ±276.12/mm 3 였으며, 성인환자 24명의총 IgE의평균은 ± IU/mL, 호산구는 ±310.26/mm 3 였다. 그러나 긴털가루진드기양성환자의피부시험의판독결과와총 간에는통계학적으로의미있는연관관계가없었다. IgE, 호산구 긴털가루진드기의전체 446 클론중에 22개클론이 fatty acid bindig protein 과상동성을이루었으며, 이중 8개클론이진드기 group 13 allergen 과유사하였다. 전체 nucleotide sequence의길이는 643으로 (Genbank accession number AY710432) open reading frame은 132 개의아미노산단백으로구성되었다. 단백질의 pi값은 7.22였으며분자 량은 kda 이었다. 아미노산배열은 Aca s 13(A. siro) 에 85.3%, Lep d 13(B. torpicalis) 에 62.3%, Lep d 13(L. destructor) 에 61.1% 의상동성이관찰되었다. 재조합 Tyr p 13(recombinant Tyr p 13, rtyr p 하도록짧은 13) 은분리에용이 N-terminal fusion protein과함께 E. coli에발현시켰다. 재조합단백질의분자량은 kda 이다. Bradford assay에의해서측 정한 rtyr p 13의발현량은 5.43 mg/ml 이었다. 재조합알레르겐인 rtyr p 에서 13은 T. putrescentiae 피부시험에양성인 78명의환자혈청중 5 명이양성반응을보였다(6.4%). T. putrescentiae 조항원은 10 μg/ml 억제농도에서 93.6% 의최대억제를보였으며, rtyr p 13은 10 μg/ml 억제농도에서 40.9% 의최대억제를보였다. 이상의결과로그동안알려진 루진드기에서 mite group 2 알레르겐외에긴털가 Tyr p 13을새로이규명하였으며그결과주알레르겐 연구에도움을줄것으로사료된다. 또한 rtyr p 13이다른진드기와 교차항원성을더규명하여, 향후긴털가루진드기유전자클로닝을 -2-

12 통한 rtyr p 13의생산으로진단용시약및치료용약제를개발하는데기초자료를제공할수있을것으로판단된다. ꠏꠏꠏꠏꠏꠏꠏꠏꠏꠏꠏꠏꠏꠏꠏꠏꠏꠏꠏꠏꠏꠏꠏꠏꠏꠏꠏꠏꠏꠏꠏꠏꠏꠏꠏꠏꠏꠏꠏꠏꠏꠏꠏꠏꠏꠏꠏꠏꠏꠏꠏꠏꠏꠏꠏꠏꠏꠏꠏꠏꠏꠏꠏꠏꠏꠏꠏꠏꠏꠏ 핵심되는말 : Allergen, ESTs, Tyrophagus putrescentiae, rtyrp13-3-

13 긴털가루진드기 (Tyrophagus putrescentiae) 의 Expressed Sequence Tags 분석및 Tyr p 13의알레르겐항원성규명 < 지도교수김규언> 연세대학교대학원의학과 김우경 Ⅰ. 서론 알레르기질환은유전적요인과환경적요인의상호작용으로생긴 다. 즉유전적소인이있는사람이주위환경에여러알레르겐에노 출되어감작이되고, 그결과로면역학적과민반응에의해서알레르 기질환이발생한다 1. 알레르겐에대한감작은유전적소인, 나이, 노 출시점, 알레르겐노출량등다양한요인에의해영향을받는다. 알 레르겐은실내 외환경에널리분포되어있고생활환경의변화로인하여알레르겐으로서의중요도도시대에따라변할수있다 3. 알레르기 질환은생활양식의변화, 인구의증가, 산업발달및대기오염의심화 와함께동 서양모두에서증가추세에있다 4,5. 즉생활환경중에서도 주거환경문화가변화하면서통풍의제한으로환기의감소, 외부환 경과의차단등과이러한밀폐된생활환경을개선하기위한시설물 개설등이알레르겐의노출증가를초래하여알레르기발생에영향이 가중된것으로추정된다 6. 알레르겐에대한노출의증가는기존에존 재하던알레르겐의단순한수적인증가뿐만아니라생활환경의변화 로인하여이전에는문제되지않았던물질이새롭게항원성을나타내어감작을일으켜질병을유발하는것으로알려져있다 7. 기존에그 중요성이확인되지않은새로운알레르겐이최근에다수밝혀지고있 2-4-

14 으며그들의특성에대한연구가많이진행되고있다 8,9. 면역학및분자생물학연구를통하여새로운알레르겐을찾아내는 것은재조합알레르겐및단클론항체의대량생산을가능하게하여 새로운진단용시약및치료용약제를개발하는데이용될수있으며, 특히대증요법만시행받고있는환자에게보다나은치료방침을제 공할수있기때문에알레르기를전공하는연구자에게중요한분야이 다. 국내가옥에서큰다리먼지진드기 (Dermatophagoides farinae), 세로무 늬먼지진드기 (Dermatophagoides pteronyssinus), 긴털가루진드기 (Tyrophagus putrescentiae) 의순으로채집되었다 10,11. 이중에서큰다 리먼지진드기와세로무늬먼지진드기는알레르기질환의주요항원으로 알려져있다 12,13. 먼지진드기의약 5~8% 를차지하는 Acarus siro(a. siro), Glycyphagus domesticus (G. domesticus), Lepidoglyphus destructor(l. destructor), Tyrophagus putrescentiae(t. putrescentiae) 등의진드기에대한감작율및감작된환자에서의연구 는아직미비한실정이다 14. 최근긴털가루진드기(Fig. 1) 도흡입성알 레르겐으로관심을끌고있다 15. 긴털가루진드기를살펴보면저장진드 기(storage mite) 로써1781년 Schrank에의해처음분류되어보고되 었다 16. 몸체는긴달걀모양이고흰색혹은누런색이며수컷의경우 체장은 280~350 μm 이고, 암컷은 320~415 μm 이다. 가로간홈에 의하여몸은앞몸체와뒷몸체로뚜렷하게구별된다. 앞몸체이웃 면에는 1쌍의작은앞머리센털과 2쌍의긴등센털이있고뒷몸체의 웃면에는 2쌍의등센털과 3 쌍의매우긴기슭센털이있다. 아래면뒤 기슭에 5쌍의크고작은센털이있는데긴것은몸체길이보다훨씬 길다. 4쌍의다리가운데서앞몸체에있는 2쌍의다리는뒤의것보 다훨씬크고발등마디에굵은뿔털이 1 개씩있다. 이들은주로식품 저장소나헛간, 곡물저장소, 건초및곡물가루내에다량분포하고 있는것으로알려져있다

15 국내에는긴털가루진드기에대한알레르기천식환자에서피부시험및 RAST로확인한보고외에는항원에대한연구가미비한실정이다 13. 구 체적으로항원을분석하고클로닝을시도한연구가별로없었다. 긴털가 루진드기의알레르겐을클로닝하고분자생물학적특성을규명하는것은 항원성(allergenicity) 과감작되는기전을연구하는데필수적이다. 이연구는긴털가루진드기의알레르겐을확인하고, 특성을규명하는데 있다. 이를위해첫째, cdna library 를제조하고둘째, 긴털가루진드기 의 DNA sequencing 하여재조합항원발현및분리하였다. 셋째, 호흡기 알레르기환자를대상으로피부시험을시행하고, 이들양성인환자에서 IgE ELISA 및억제 ELISA 실험을시행하여긴털가루진드기의항원성 및특이성을확인함으로서, 본연구는알레르겐의구조와항원성을연구 하는데이용하고자하였다. Fig. 1. A photo of Tyrophagus putrescentiae(100x). -6-

16 Ⅱ. 재료및방법 1. 재료 가. 긴털가루진드기조항원제조 실험실에서사육한 30 g의긴털가루진드기를액체질소를이용하여 막자사발에서분쇄하였다. 지질을제거하기위하여 1:1의비율로섞 은 ethyl ether와 ethyl acetate 200 ml를붓고 18 시간증발시켰다. 탈지한시료를 6 mm 2-mercaptoethanol, 1/1000로희석한 protease inhibitor set Ⅲ (Calbiochem, San Diego, CA, USA) 와 1 mg/ml의 1-phenyl-3-(2-thiazolyl)-2-thiourea (Sigma, St. Louis, MO, USA) 가섞인 phosphate-buffered saline, ph 7.4를붓 고 4 에서 18시간천천히 stirring 하여단백질을추출하였다. 추출물 을 4 에서 g으로 30 분간원심분리한후, 상청액을 0.22 μm filter (Millipore, Bedford, MA, USA) 로거른후사용할때까지 -7 0 에보관하였다. 나. 긴털가루진드기피부시험시약제조 재료및방법 1- 가) 항의방법으로제조한동결건조조항원을 Coca 용액 (0.9% NaCl, 0.25% NaHCO 3, 0.4% phenol) 에희석한후동량의멸균소독된 glycerin과혼합하여피부시험용시약을제조하여알 레르기피부시험에사용하였다. 피부시험에는 1:100(w/v) 로희석하여 사용하여최종농도는 200 μg/ml 이었다. 2. cdna expression library 의제조 가. 전체 RNA 및 mrna의분리 긴털가루진드기충체에 denaturing 용액(5 M guanidium thiocyanate, 10 mm EDTA, 2% SDS, 25 mm Tris-HCl, ph 7.6) -7-

17 을넣어용해시킨후, phenol/chloroform을이용하여단백질을제거 하였다. Isopropyl alcohol을첨가한후 Resin Tack을이용하여 RNA 를침전시키고, 이를건조하여 diethyl pyrocarbonate(depc) 를 처리한증류수에녹여 1 분간원심침전하여상청액을분리하였다. 전 체 RNA 용액을 oligo-dt가부착된 Dynabead의 Magnetic particle collection kit를이용하여 bead와결합한 mrna를모아 DEPC를처 리한증류수에녹여 -70 에보관하였다. 나. cdna library 제작 ZAP-cDNA Synthesis kit (Stratagene, La Jolla, USA) 를이용하여 directional cloning 하였으며, 방법은제공되는설명서를따랐다. 위에 서기술한바에따라재취보관한진드기의 5 μg mrna를사용하여 먼저 first strand 를합성하였다. dithiothreitol(dtt), first strand methyl nucleotide mixture, linker-primer, RNase inhibitor 들을적 정농도가되도록넣고, poly A mrna 5 μg을넣어잘섞은후에, 여기에 M-MLV reverse transcriptase를넣고 37 에서반응시켰 다. 반응후 first strand에 DTT, second strand nucleotide mixture, dntp, RNase H, DNA polymerase를넣고 16 에서 2.5 시간반응시켜 second strand 를합성하였다. Phenol:chloroform를 첨가하고상청액을분리한후얻어진 double stranded DNA를 alcohol precipitate 시켰다. Klenow fragment 및 dntp mix를사용 하여, cdna termini를 blunting 시키고, EcoRI adaptors를 ligation 시켰다. T4 polynucleotide kinase 및 ratp들을섞어 EcoRI ends 를 kination 시키고, Xho I 으로소화시켰다. 이렇게준비한 cdna를 Uni-ZAP XR vector에 T4 DNA ligase 등을사용하여 ligation시켰 다. Gigapack Ⅱ Gold packaging extract를사용하여 in vitro packaging 시켰다. XL 1-Blue MRF' bacteria를숙주세포로길러 plating과 titering 에사용하였다. -8-

18 다. In vivo excision ZAP Express vector에있는 phagemid를분리하기위하여숙주세 포 SOLR과 ExAssist helper phage를이용하여 in vivo excision을 수행하였다. 3차 screening을통하여최종적으로분리된 phage ( pfu/ml) 250 μl를 XL1-Blue MRF' (O.D. L와 1 μl의 ExAssist helper phage ( = 1.0) 200 μ pfu/ml) 에섞어서 15 분간 37 에서반응시켰다. 3 ml의 NZY broth를첨가한뒤 3시간 동안배양하여 excision 이일어나도록하였다. 그다음 70 에서 20 분간열처리한후원심분리 를취한다음 (1,000 g, 15 분) 를하여상청액 100 μl 100 μl의 SOLR (O.D. 600= 1.0) 과섞어 15분간 37 에배양하여형질전환시켰다. 300 μl의 NZY broth를첨가한후 3 7 에서 45분간더배양하여그중 50 μl를 LB/ampicillin (50 L/mL) agar plate 에고르게폈다. 16시간배양하여생성된 colony에 서다시 plasmid를추출하여재조합 DNA의크기를확인한후 E. coli 에다시형질전환하여이후의실험에사용하였다. μ 3. DNA sequencing 형질전환된 E. coli에서 plasmid를 QIAprep Spin Miniprep Kit (QIAGEN, Valencia, CA, USA) 를이용하여얻은후제한효소 EcoR Ⅰ과 XhoⅠ 으로 37 에서 1시간절단후 cdna insert 크기를 1% agarose gel 에전기영동하여확인하였다. 염기서열결정은 dideoxy chain termination 방법을기초로한 ThermoSequenase kit (Amersham Life Science, Cleveland, OH, USA) 와 Long ReadIR 4200 DNA sequencer (LI-COR, Lincoln, NE, USA) 를사용하였으며, insert에대해 5' 과 3' 양쪽으로동시에시행하였다 18. Sequencing primer로는 T3 (5'-AATTAACCCTCACTAAAGGG-3') 와 T7-9-

19 (3'-CGGGATACCACTCAGCATAATG-5') 을사용하였다. 5 μg의 plasmid DNA를 ssdna로변성시킨후각각의 primer를상보적인 DNA 에결합시켰다. 이를상온에서약 5 분간 [ 35 S]dATP로표지화시 키고각각의 dideoxy NTP가들어있는 tube에옮겨 37 에서 5분간 반응시켰다. 각각의반응산물을 6% polyacrylamide gel에전기영동 한후 X-ray film 에감광시켜판독하였다. 판독한 DNA 염기서열자 료는 BLAST (Basic Local Alignment Search Tool) 를사용하여 GenBank, EMBL의 을분석하였다. database들과비교하여유전자의유사성과특성 4. 재조합항원의발현및분리 가. Fatty acid binding protein 유전자의발현벡터로의 subcloning RT-PCR을수행하여 pgem-t Easy vector (Promega, Madison, WI, USA) 에클로닝한후, EcoRI 제한효소를처리하여 expression vector인 pet 28b (Novagen, Madison, WI, USA) 에삽입하였다. 나. 재조합알레르겐의발현및분리 Subcloning한 plasmid를 E. coli BL21에형질전환하여과발현을 유도하였다. 50 μg /ml의 kanamycin을포함한 LB broth에 37 에서 배양하다가 OD 600 값이 0.5일때 1 mm isopropyl-beta-d-thiogalactopyranoside (IPTG) 를첨가하고 5시간더 배양한후 bacteria 를모았다. 2 L 배양하여 sonicator로 1분씩 5회 sonication 한다음 10,000 g에서 1시간원심분리하여상청액을모 았다. 6 M urea 용액으로 insoluble fraction 을추출하고, 이후에도 6 M urea 를포함하는용액을이용하여단백질을분리하였다. 20 mm imidazole 용액으로평형시킨 4 ml의 Ni-nitrilotriacetic agarose resin (Qiagen) 과 20분동안상온에서 shaking하며결합시 -10-

20 킨후, 60 mm imidazole 용액으로세척하고 250 mm imidazole 용 액 3 ml로 elution 하였다. 이렇게얻은용액을 phosphate buffer, ph 7.4 로투석하고정량하여사용하였다. 5. 긴털가루진드기알레르겐의특성규명 가. 대상환자 2003년 12월부터 2004년 7월 31일까지연세대학교세브란스병원 알레르기클리닉또는인제대학교서울백병원소아과에내원하여천 식, 알레르기비염, 아토피피부염등알레르기질환으로진단된환자 는소아환자 432명과성인 24 명을대상으로긴털가루진드기제조 항원( 재료및방법 1- 나) 과 D. pteronyssinus, D. farinae, Alternaria tenuis, Penicillium, Blattella germanica, Periplaneta americana, cat, dog, alder, oak, ragweed 총 12 가지항원(Torii. Co, Ltd, Tokyo, Japan) 을사용하여알레르기피부시험을실시하였다. 판정은 Vanselow 의기준에의하여팽진이 5mm이상인경우는 4+,3~5mm인경우는 3+,2~3mm이고홍반이 21mm이하인경우는 2+,2mm이하이고홍 반이 21 mm이하인경우는음성으로분류하였다 histamine 과생리식염수를사용하였다. 피부시험결과에서긴털가루진드기에양성인환자의혈청 0 에보관하였다. 19. 대조군으로는 3mL을 -7 나. 알레르기항원성의재검정 1) ELISA 시험 재조합알레르겐을 microtiter plate well에 200 ng씩 coating 하고, 1:4로희석한환자혈청은 50 μl/well과 1 시간반응, 1% bovine serum albumin과 0.05% Tween 20을포함한 PBS에 1: 1000으로 희석한 biotinylated goat anti-human IgE (1:1000, Vector) 와 1시 간반응시킨후, 1:1000으로희석한 streptoavidin-peroxidase -11-

21 (Sigma, St. Louis, MO, USA) 를차례로 30 분반응한후, 3, 3', 5, 5'-tetramethyl-benzidine(TMB; Kirkegaard & Perry Laboratories, Gaithersburg, MD, USA) 을기질로이용하여발색반 응을수행하였다. 두번의반복실험하였으며, 정상인혈청의평균 +2SD( 표준편차) 를기준으로이용하였다. 2) ELISA 억제시험 20 μg/ml의농도의조항원을 100 μl씩 microtiter plates에 coating 하였다. 다양한농도로희석한재조합항원과재조합양성혈 청을상온에서 2 시간, 4 에서 overnight반응시킨후 ELISA 반응을 시행하였다. 1:1000으로희석한 biotinylated goat anti-human IgE(Vector) 에 1 시간, 1:1000으로희석한 streptoavidin-peroxidase(sigma) 를차례로 30 분반응한후, TMB(Kirkegaard & Perry Laboratories) 을기질로이용하여발색반 응을수행하였다. 다. 통계분석 환자의혈액검사, 피부시험, 환자의특이 IgE 검사간에통계학적처리 를 SPSS 10.0 프로그램을이용하여 t-test 를실시하였으며, p값이 0.05 이하인경우의미있는것으로해석하였다. -12-

22 Ⅲ. 결과 1. Expressed sequence tags( ESTs) 의데이터베이스의분석 전체 446 클론중에 56 개는기존에알려진클론이없었고, 8개는 sequencing 되지않았다(Table 1). 반면에 382개는기존에알려진아미 노산 encoding sequence 와상동성을보였으며, 이러한상동성을보인 22개클론의분석은 Table 2 와같다. Table 1. ESTs of the T. putrescentiae cdna library EST match category Clones Match 382 No match 56 Not correct 8 Total 446 Table 2. Significant matches of T. putrescentiae ESTs with sequences present in DNA and protein databases * No. EST Species Putative identificaiton e-value 21 Fatty acid-binding Blomia tropicalis Allergen Blo t 13, 2.00E-58 protein 22 Troponin C Anopheles troponin I isoform a2 7.00E-24 gambiae [Drosophila pseudoobscura] 28 Hypothetical protein Caenorhabditis cysteine proteinase 1.00E-13 CBG01480 briggsae [Caenorhabditis elegans] 41 Fatty acid-binding Drosophila adipocyte fatty 2.00E-08 protein melanogaster acid-binding protein [Sus scrofa] 58 Fatty acid-binding Blomia tropicalis Allergen Blo t 13, 1.00E-58 protein 89 Troponin C Tachypleus Cockroach group E-47 tridentatus 115 Putative cysteine proteinase CG12163 precursor Drosophila melanogaster cysteine proteinase [Dermatophagoides farinae] Group1 2.00E

23 No. EST Species Putative identificaiton e-value 161 protein for MGC:75969 Silurana tropicalis cathepsin B precursor [Araneus ventricosus] 2.00E tropomyosin Dermatophagoid mite group E-75 -es farinae 186 Serine protease Anopheles Delta tyrpsin [Drosophila gambiae erecta], mite group glutathione S Culicoides group E-33 transferase-1 variipennis 242 thiol protease Phaedon cysteine protease 1.00E-26 cochleariae [Arabidopsis thaliana] 259 α-tubulin Lepidoglyphus destructor allergen Lep d 21, 1.00E arginine kinase Callinectes sapidus Possible allergen; Pen m 1.00E-12 2[Penaeus monodon], Plo i lysosomal thiol reductase IP30 precursor Mus musculus Immunity CG31305-PJ Drosophila Fatty acid-binding protein 3.00E-08 melanogaster (Allergen Lep d 13) 445 Fatty acid-binding protein (Allergen Lep d 13 Lepidoglyphus destructor Fatty acid-binding protein (Allergen Lep d 13) 4.00E Fatty acid-binding Blomia tropicalis Fatty acid-binding protein 2.00E-58 protein (Allergen Blo t 13) (Allergen Blo t 13) 479 (Allergen Blo t 13) Blomia tropicalis Fatty acid-binding protein (Allergen Blo t 13) 2.00E Serine protease Drosophila CUB-serine protease 6.00E-11 melanogaster [Panulirus argus] 513 glutathione Mus musculus Group E-20 S-transferase 606 Troponin C Anopheles gambiae troponin I isoform a2 [Drosophila 2.00E-18 pseudoobscura] * Matches were sorted into functional categories, and only representative match is given. -14-

24 2. 긴털가루진드기의 fatty acid binding protein의상동성 전체클론중에서 22개클론이다른기존에알려진알레르겐과상동성 을이루었으며, 이중 8개클론이 mite group 13 allergen과유사하였 고, 그중에서 6개가 open reading frame이확인되는 full-length의 clone 이였다(Table 3). Table 3. Expressed sequence tags(est) match with allergenic clones Allergen Biochemical identity Clone s(n=2 2) EST numbers Tyr p 13 Fatty acid binding 8 21 *, 41, 58 *, 366 *, 433, protein 445 *, 472 *, 479 * Tyr p 1 Cysteine protease 4 28, 115 *, 161, 242 Tyr p 3 Serine protease *, 485 Tyr p 8 Glutathione-S-transferas e 2 188, 513 Tyr p 10 Tropomyosin Tyr p 20 Arginine kinase α-tubulin * - Troponin C 3 89, 22, 606 * Full-length, Partial-length -15-

25 전체 nucleotide sequence의길이는 643 이다(Genbank accession number AY710432). 이것은 59 bp, 184 bp의 5' noncoding region과 396 bp의 3'-untranslated region 및 open reading frame이포함되었 다. 이 open reading frame은 132 개의아미노산단백으로구성되며, 단 백질은농전점 (isoelectrical point, pi) 값이 7.22인 kda이었다 (Fig. 2). -59 GGCCAAATC GATCTCGACT TTTTCGGTCT TTCACCACCC CCTCAAACTA AACCCTCACC 1 ATGGTTCAAC TGAACGGCTC CTACAAGCTC GAGAAGAGCG ACAACTTTGA TGCCTTCCTC M V Q L N G S Y K L E K S D N F D A F L AAGGAACTCG GCGTCAACTT TGTGACCCGA AACCTCGCCA AGTCGGCCAG CCCCACCGTG K E L G V N F V T R N L A K S A S P T V GAGGTGATCG TCGACGGCGA CAGCTACACC ATCAAGACCA GCTCCACGCT GAAGAACAGC E V I V D G D S Y T I K T S S T L K N S GAGATCAAGT TCAAGCTGGG CGAGGAGTTC GAGGAGGACC GCGCCGACGG CAAGAAGGTG E I K F K L G E E F E E D R A D G K K V CAGACCTCGG TCACCAAGGA GGGCGACAAC AAGCTGGTGC AGGTGCAGAA GGGCGACAAG Q T S V T K E G D N K L V Q V Q K G D K CCGGTGACCA TTGTGCGGGA GTTCAGCGAG GAGGGCCTCA CCGTCACCGC CACCGTCAAC P V T I V R E F S E E G L T V T A T V N GGCGTCACCT CGGTGCGATT CTACAAGCGC CAGTAAACAG AATGAACAGA ACAAAAAATT G V T S V R F Y K R Q *** CTCCTCACAT TCCGGTAGAT TTACTGTTCA CTGTTTACCA TAAAAACAAC CCCCACACCA 481 CCAAGATCTT CTGAAAATCC AATTTTTCAT CTATCTATCA ATCAGTTATT TTTGATTGGC 541 TAATAAATAA TTTATTGCAC TTCAAAAAAA AAAAAAAAAA AAAA Fig. 2. Nucleotide and deduced amino acid sequences of T. putrecsentiae fatty acid binding protein. The estimated molecular weight is kda, and the estimated isoelectrical point was

26 PROSITE program에의하여 5-22 위치에서 cytosolic fatty acid binding protein 이존재하고, 5-7 위치에 potential N-glycosylation site 가있다. Nucleotide residues 542 와 548 사이에 putative polyadenylation signal 를찾을수있다(Fig. 3). Fig.3.AthreedimensionalstructuralmodelofTyrp13.ClustalW multiple sequence alignment program was used to select and align the sequence before modeling. Structural prediction was done using the software ExPASy ( -17-

27 아미노산배열은 Aca s 13(A. siro) 과 85.3%, Blo t d 13(B. torpicalis) 과 62.3%, Lep d 13(L. destructor) 과 61.1% 의상동성이관 찰되었다(Fig. 4). 이런상동성을보인아미노산배열이 group 13 mite 항원과의높은연관성으로때문에항원명명법에의하여 명하였다 20. Tyr p 13로명 Tyr p 13 MVQLNGSYKLEKSDNFDAFLKELGVNFVTRNLAKSASPTVEVIVDGDSYTIKTSSTLKNS 60 Aca s I...L...T...S.N...A...T 58 Lep d 13.ANIA.Q...D..E...Q..DK...G.LVKTA..TVK..L..A...T.IFRSL..F..T 60 Blo t 13.P-IE.K...K..D...G.MVKTA..TLK..L..D.Q..T.VFRSL..F..T 59 Tyr p 13 EIKFKLGEEFEEDRADGKKVQTSVTKEGDNKLVQVQKGDKPVTIVREFSEEGLTVTATVN 120 Aca s 13..S...A...T.K.V.N..S.T.F...Q...E...D Lep d 13...R.K.VIV.D...F..T.Y...E.KV...KGDEVE...S.D 120 Blo t 13...R.K.V.N...FI.T.Y...E.K...D.QGDDVV...S.G 119 Tyr p 13 GVTSVRFYKRQ 131 <100.0%> Aca s <85.3%> Lep d 13...P...A 131 <61.1%> Blo t 13 D...T...I 130 <62.3%> Fig. 4. Amino acid sequence alignment of four arthropod fatty acid binding proteins: Aca s 13 (Acarus siro, accession number AJ006774), Lep d 13 (Lepidoglyphus destructor, accessionnumber Q9U5P1), Blo t 13 (Blomia tropicalis, accession number Q17284). A dot indicates amino acid identity with T. putrescentiae and the percentage of each sequence identity is given in parentheses. -18-

28 3. 대상환자의특성 총대상소아환자 432명중천식은 358 명, 알레르기비염은 325 명, 아 토피피부염은 17 명, 두드러기는 6 명이었고, 두가지이상의질환이동반 된경우가 318 명이었다. 이들소아환자의남녀비는 223:209였으며연 령은 8.4±3.2 세(3세 3개월~15세 8 개월) 이었다. 대상자중에서긴털가 루진드기피부시험에양성인소아환자 54명은남녀비는 26:28였으며 연령은 7.3±1.5 세(3세 3개월~11 세) 였다. 또한긴털가루진드기에양성 인성인은 24명의남녀비는 17:7 였으며, 연령은 27.4±10.5 세 (18~60 세였다 ). 4. 소아환자의피부시험 소아환자 432명에서 12개항원에대한피부시험의양성률은 D. pteronyssinus(69.5%), D. farinae(57.8%), B. germanica(34.2%), P. americana(22.3%), cat(16.3%), Alternaria(15.7%), dog(12.8%), T. putrescentiae(12.7%), Penicillium(6.0%), oak(5.3%), ragweed(4.4%), alder(4.2%) 순으로나타났다. 소아및성인의피부시험결과중에서긴털가루진드기항원만살펴보면 1+ 가 10 례(12.8%), 2+ 가 24 례(30.7%), 3+ 가 38 례(48.7%), 4+ 가 6례 (7.7%) 였다. 5. 긴털가루진드기양성환자의총 IgE와호산구 소아환자 54명의총 IgE의평균은 ± IU/mL, 호산구는 ±276.12/mm 3 였으며, 성인환자 24명의총 IgE의평균은 ± IU/mL, 호산구는 ±310.26/mm 3 였다. 6. 긴털가루진드기피부시험양성결과와혈액검사의상관성 긴털가루진드기양성환자의피부시험판독결과와총 간에는통계학적의의가없었다( 자료제시하지않음.). IgE, 호산구 -19-

29 7. 재조합 Tyr p 13의 IgE binding과발현 재조합 Tyr p 13(recombinant Tyr p 13, rtyr p 13) 은분리에용이 하도록 short N-terminal fusion protein (MGSSHHHHHHSSGLV- HSSGLVPRGSHMASMTGGQQMGRDPNSL) 과함께 E. coli 에발현시 켰다. 그결과재조합단백질의분자량은 kda 이다(Fig. 5) Fig. 5. Purification of the recombinant Tyr p 13. Proteins were separated under reducing conditions on 15% acrylamide gels and stained with Coomassie brilliant blue. Lanes: M, MW markers in kda;l,totalcelllysateofe. coli BL21 cells bearing rtyr p 13 after IPTG induction ; W, fraction washed from the column; E, fraction eluted -20-

30 Bradford assay에의해서재조합 Tyr p 13의발현량은 mg/ml 으로측정되었다. 조항원에대한환자혈청의 IgE 반응을확인하였다 (Fig 6). Absorbance at 450 nm 2.5 : H ealthy control : T. putrescentiae allergic sera Fig. 6. IgE reactivity of human sera against T. putrescentiae crude extract. The dotted line indicates a cut-off value. 재조합알레르겐인 명의환자혈청중에서 rtyr p 13은 T. putrescentiae 피부시험양성인 78 5 명이양성반응을보였다(6.41%)(Fig. 7). 5/78(6.41%) Fig. 7. IgE reactivity of human sera against recombinant Tyr p 13. Thedottedlineindicatesacut-offvalue. -21-

31 8. 재조합 Tyr p 13의억제시험 5명의환자혈청중에서제일높게측정된환자혈청 1명에서 T. putrescentiae 조항원은 10 μg/ml 억제농도에서 93.6% 의최대억 제를보였으며, 재조합 Tyr p 13은 의최대억제를보였다 (Fig. 8). 10 μg/ml 억제농도에서 40.9% Inhibition (%) 계열 1 계열 2 Crude extract Recombinant Tyr p Inhibitor ( μg /ml) Fig. 8. Inhibition ELISA of T. putrescentiae crude extract and recombinant Tyr p

32 Ⅳ. 고찰 진드기는그종류가다양할뿐만아니라기후나지역에따라서그 분포양상도매우다양하다. 세계적으로가옥내우점종은주로 pyroglyphid 진드기인 D. pteronyssinus와 D. farinae 이며 21, 남반구 나열대지방에서는 non-pyroglyphidae인 Blomia spp. 등이보다 많은것으로알려져있다 22,23. 또한도시지역은 pyroglyphid 진드기가 농촌지역에비해많다 24. 국내보고에서도가옥내먼지에서 D. farinae(60.7%),d. pteronyssinus(21.4%) 에이어서 T. putrecentiae( 7.1%) 순으로조사되었다 창고나가축우리, 밀가루등에서주로발견된다 11. 이들은주로건초곡물, 사료등의저장 25,26. 국내에서는서울 지역저장식품및그주위환경에서 T. putrecentiae 와 A. siro 를 포함한 12 종의진드기류가채취되었으며, 긴털가루진드기는습기가 많은지역의가옥이나식료품상점등에서도높게분포하였다 27. 저장진드기의알레르겐에대한사례가보고되었는데, 그중에서기 관지천식이있는환자에서곡물가루로시행한기관지유발시험에 양성인환자의곡물가루속에서 Glycophagus destructor 를발견하 므로인해, 저장진드기가원인알레르겐의가능성을보고하였다 또한농촌지역에서건초와곡물에다량노출된기관지천식환자에서 Tyroglyphus longior 추출액을이용한기관지유발시험에서양성인 예가보고되었고, 이로인하여농촌지역의곡물취급자들에있어서 의기관지천식의원인알레르겐으로저장진드기의중요성이강조되 고있다 29. 본연구에서소아환자에게시행한피부시험에서 D. pteronyssinus, D. farinae, B. germanica, P. americana, cat, Alternaria, dog, T. putrescentiae, Penicillium, oak, ragweed, alder의순으로양성반응을 나타내었으며, 이들중 T. putrescentiae는 12.7% 의감작율을보였다. Warren 등은저장진드기에대한피부시험에서기관지천식환자의

33 4~12% 의낮은감작율을보고하고있으나 30, 다른보고자에의하면 72례의호흡기알레르기환자들에서피부시험결과 L. destructor(79.2%), G. domesticus(76.4%), A siro(72.2%), T. putrescentiae(70.8%) 에대한높은양성률을보고하면서, 습기찬주 택에거주하거나정미소에서일하는경우, 농부들에있어서감작율이 높았다고하였다 31. 국내농촌지역에서는 D. farinae(31.2%), T. putrescentiae(30.8%), D. pteronyssinus(29.9%), cockroach(25.0%) 등의감작율이높았다는보고도있다 32. 지금까지보고에서는주로농촌 거주자및성인에서실시되어왔다. 그러나본연구에서는대상환자가 소아가주를이루어곡물가루등에노출이적었을것으로보이며, 또한대부분곡물가루등에노출이적은도시거주자이어서다른보 고에비해감작률이낮았을것으로추정된다. 저장진드기의성분분석에서사용한 fatty acid binding protein은 Fasciola hepatica, Schistosoma japonica, Schistosoma mansoni 등의기생충에서처음밝혀졌다 그리고처음알레르기와연관된 fatty acid binding protein은 Ascaris suum size의 ABA-1에서기술되었다 36. 본연구에서긴털가루진드기의전체클론중에서22개클 론이다른기존에알려진알레르겐과상동성을이루었으며, 이들로는 8 개클론이먼지진드기 group 13 allergen(tyr p 13), Tyr p 1, Tyr p 3, Tyr p 8, Tyr p 10, Tyr p 20 등에서상동성을보였다. ABA-1와는 상동성이높지않았으나, 먼지진드기 group 13인 fatty acid binding protein 과상동성을보였다 적었던 Tyr p 13 으로연구를시행하였다. 37. 따라서본연구에서는현재까지보고가 지금까지는먼지진드기알레르겐에대한보고에서는주로집먼지진드 기의 group 1과 2 를주알레르겐으로보고되었다. 기존연구에서는긴 털가루진드기와의교차반응을보기위해서 었다 38 Tyr p 2의연구가주를이루. 그러나 D. farinae와 D. pteronyssinus는먼지진드기 group 13 의특성이아직규명되지않아서본연구에서 Tyr p 13과 D. farinae 와 -24-

34 D. pteronyssinus간의교차반응은조사할수없었다. 반면, L. destructor(lep d 2), T. putrescentiae(tyr p 2), D. pteronyssinus(der p 2) 등이들은아미노산서열이잘보존되어있 고서로교차반응을일으키는것으로알려져있어서, 이들과비교하 여보면 Lep d 2(L. destructor) 와 Tyr p 2(T. putrescentiae) 는 43%, Lep d 2와 Der p 2는 37%, Tyr p 2와 Der p 2는 40% 에서상동성이있다고보고되어있다 8. 이렇게상동성을보이는이유로는 긴털가루진드기는저장진드기로써주형강(class Arachnida) 중에서가 장인간생활과관계깊은목(order) 의 Acari, 아목(suborder) 의 Astigmata, 과(family) 의 Acaridae 에속하기때문으로생각할수있 다 39. 다른보고에서는긴털가루진드기의체부(body) 와배지( 주로분 변) 내에각각 20개와 18 개의항원, 그리고 5개의알레르겐을밝혀낸 바있으며, 이들저장진드기사이의교차반응은주로동일한과 (family) 사이에는강하나다른과(family) 사이에는미약하다는보고 도있다 40. SDS-PAGE와 immunoblotting으로밝혀진긴털가루진드기추출물 의전체분자량범위는 16~33 kda 이다. 이중에서 16 kda이주요 알레르겐으로 80% 다른진드기와 RAST에서교차반응을일으키는 것으로보고되고있다 41. 본연구에서는전체분자량이 kda이 었으며, 재조합 Tyr p 13은 kda 으로측정되었으며, 긴털가루 진드기알레르겐의교차항원성을확인한결과에서 Aca s 13(A. siro) 에 85.3%, Blo t 13(B. torpicalis) 에 62.3%, Lep d 13(L. destructor) 에 61.1% 의상동성을보였다. 이러한상동성은진드기의계통유연관계 와일치한다 (Fig. 9). 알레르겐은수십개의항원성분을가진단백질복합체로구성되어있 다. 단백질구성성분중 IgE 항체반응을일으키는부분이알레르겐 이며, 이를증명하기위해서억제시험을실시하는데이때 50% 이 상되어야한다 42. 그러나본연구에서억제시험에서강한 IgE 항체반 -25-

35 응을보인환자 1명에서만 40.9% 를보였는데, 이는환자군이농촌이 아닌도시거주자로인하여 이상의결과로그동안알려진먼지진드기 IgE 항체반응이낮았을것으로추정된다. group 2외에새롭게긴 털가루진드기에서주알레르겐연구에도움을줄것이며, 하지만본 연구에서대상환자군이긴털가루진드기에대한양성률이높은농촌 거주자가아닌도시거주자들이며성인보다소아에서시행하므로인하 여양성률이낮았을것으로추정할수있다. 긴털가루진드기의양성률및이들에서특이 요할것으로사료되며, 향후농촌거주자에서의 IgE을규명하는것이필 본연구가향후긴털가루진드기유전자클로 닝을통한재조합알레르겐의생산으로진단용시약및치료용약제 를개발하는데기초자료를제공할수있을것으로판단된다. CLASS SUBCLASS SUBORDER FAMILY GENUS Acaridae Acarus Aleuroglyphus Araneae Tyrophagus (spiders) Glycyphagidae Lepidoglyphus Glycophagus Arachnida Scorpiones (scorpions) Astigmata Chortoglyphidae Blomia Chortoglyphus Pyroglyphidae Dermatophagoides Acari Euroglyphus (mites and ticks) Prostigmate Cheyletidae Cheletus Fig. 9. The taxonomic position of Tyrophagus putrescentiae. -26-

36 Ⅴ. 결론 알레르기질환에서알레르겐의노출시기, 노출량등은매우중요하며, 이전국내보고에서가옥내먼지에서 Tyrophagus putrecentiae가 3번째로많이분포하며알레르기질환을유발시킬수있는알레르겐으로이들의특성을연구하여다음과같은결과를얻었다. 1. 알레르기피부시험에서 T. putrecentiae는 12.7% 의감작율를보였 다. 2. T. putrecentiae 양성환자의피부시험의판독결과와총 IgE, 호 산구간에는통계학적의의가없었다. 3. 전체 446 클론(clones) 중에 22개클론이다른기존에알려진알레 르겐과상동성을이루었으며, 이중 8개클론이먼지진드기 group 13 allergen 과유사하였다. 4. T. putrecentiae 알레르겐의 교차항원성을 확인한 결과 Aca s 13(A. siro) 에 85.3%, Blo t 13(B. torpicalis) 에 62.3%, Lep d 13(L. destructor) 에 61.1% 의상동성을보였다. 5. Tyrophagus putrecentiae의단백질은농전점값이 7.22 이었으며, 분자량은 kda 이었다. 재조합Tyr p 13의분자량은 kda 으로측정되었다. 6. T. putrescentiae 조항원은 10 μg/ml 억제농도에서 93.6% 의최 대억제를보였으며, 재조합 Tyr p 13은 10 μg/ml 억제농도에서 40.9% 의최대억제를보였다 이상의결과로그동안알려진먼지진드기가루진드기에서 group 2외에새롭게긴털 Tyr p 13이주알레르겐연구에도움을줄것으로사 료된다. 또한재조합 Tyr p 13이다른진드기와교차항원성을더규명하여, 향후 T. putrecentiae 유전자클로닝을통한재조합Tyrp 13의생산으로진단용시약및치료용약제를개발하는데기초자료를제공할수있을것으로판단된다. -27-

37 참고문헌 1. Boulet LP, Turcotte H, Laprise C, Lavertu C, Bedard PM, Lavoie A, et al. Comparative degree and type of sensitization to common indoor and outdoor allergens in subjects with allergic rhinitis and/or asthma. Clin Exp Allergy 1997;27: GergenPJ,TurkeltaubPC,KovarMG.Theprevalenceof allergic skin test reactivity to eight common aeroallergens in the U.S. population: results from the second National Health and Nutrition Examination Survey. J Allergy Clin Immunol 1987;80: Brown CW, Hawkins L. Allergy prevalence and causal factors in the domestic environment: results of a random population survey in the United Kingdom. Ann Allergy Asthma Immunol 1999;83: Polosa R. Prevalence of atopy and urban air pollution: dirty business. Clin Exp Allergy 1999;29: 강영모, 허영구, 최귀애, 김향재, 김능수. 알레르기병력이없는한 국인에있어서의피부단자시험성적. 알레르기 1989;9: Ledford DK. Indoor allergens. J Allergy Clin Immunol 1994;94: Platts-Mills TA. How environment affects patients with allergic disease: indoor allergens and asthma. Ann Allergy 1994;72: Gafvelin G, Johansson E, Lundin A, Smith AM, Chapman MD, Benjamin DC, et al. Cross-reactivity studies of a new group 2 allergen from the dust mite Glycyphagus domesticus, Gly -28-

38 d 2, and group 2 allergens from Dermatophagoides pteronyssinus, Lepidoglyphus destructor, and Tyrophagus putrescentiae with recombinant allergens. J Allergy Clin Immunol 2001;107: Curtis L, Lee BS, Cai D, Morozova I, Fan JL, Scheff P, et al. Pigeon allergens in indoor environments: a preliminary study. Allergy 2002;57: Jeong KY, Lee IY, Lee HI, Ree HI, Hong CS, Yong TS. Effectiveness of health education for the control of house dust mites and cockroaches in Seoul, Korea. Med Vet Entomol in press. 11. Ree HI, Jeon SH, Lee IY, Hong CS, Lee DK. Fauna and geographical distribution of house dust mites in Korea. Korean J Parasitol 1997;35: Verhoeff AP, Van Strien RT, Van Wijnen JH, Brunekreef B. Housedustmiteallergen(DerpI)andrespiratorysymptoms in children: a case-control study. Clin Exp Allergy 1994;24: 박해심, 강신욱, 홍천수. Tyrophagus putrescentiae에대한피부반 응도및 RAST 에관한연구. 알레르기 1988;8: Pollart SM, Platts-Mills TA. Mites and mite allergy as risk factors for asthma. Ann Allergy 1989;63: Cuthbert OD, Brostoff J, Wraith DG, Brighton WD. 'Barn allergy': asthma and rhinitis due to storage mites. Clin Allergy 1979;9: 조백기. 한국의집먼지진드기에관한연구. 가톨릭대학의학논문집 1980;33: Olsen AR. Regulatory action criteria for filth and other -29-

39 extraneous materials. II. Allergenic mites: an emerging food safety issue. Regul Toxicol Pharmacol 1998;28: Tabor S, Huber HE, Richardson CC. Escherichia coli thioredoxin confers processivity on the DNA polymerase activity of the gene 5 protein of bacteriophage T7. J Biol Chem 1987;262: Vanselow NA. Skin testing and other diagnostic procedures. In Sheldon JM, Lovell RG, Pathew KP eds. A manual of Clinical Allergy 2nd ED., Philadelphia and London, W.B. Saunders Co. 1967: King TP, Hoffman D, Lowenstein H, Marsh DG, Platts-Mills TAE, Thomas W. Allergen nomenclature. Int Arch Allergy Immunl 1994;105: Platts-Mills TA, Thomas WR, Aalberse RC, Vervloet D, Champman MD. Dust mite allergens and asthma: report of a second international workshop. J Allergy Clin Immunol 1992;89: Hurtado I, Parini M. House dust mites in Caracas, Venezuela. Ann Allergy 1987;59: Fernandez-Caldas E, Fox RW, Bucholtz GA, Trudeau WL, Ledford DK, Lockey RF. House dust mite allergy in Florida. Mite survey in households of mite-sensitive individuals in Tampa, Florida. Allergy Proc 1990;11: 이완구, 조백기. 집먼지진드기류의생태학적연구. 대한피부과학 회지 1984;22: Terho EO, Leskinen L, Husman K, Karenlampi L. Occurrence of storage mites in Finnish farming environments. Allergy 1982;37:

40 26. van Hage-Hamsten M, Johansson E, Wiren A, Johansson SGO. Storage mites dominate the fauna in Swedish barn dust. Allergy 1991;46: 이원구, 최원영. 한국산진드기류의분류학적연구. 기생충학잡지 1980;18: DaviesRJ,GreenM,SchofieldNM.Recurrentnocturnalasthma after exposure to grain dust. Am Rev Respir Dis 1976;114: Ingram CG, Jeffrey IG, Symington IS, Cuthbert OD. Bronchial provocation studies in farmers allergic to storage mites. Lancet 1979;2: Warren CP, Holford-Strevens V, Sinha RN. Sensitization in a grain handler to the storage mite Lepidoglyphus destructor. Ann Allergy 1983;50: Wraith DG, Cunnington AM, Seymour WM. The role and allergenic importance of storage mites in house dust and other environments. Clin Allergy 1979;9: 이재영. 대전지역의알레르기크리닉을방문한환자에서긴털가루진 드기의감작률. 천식및알레르기 2002;22: Rodriguez-Perez J, Rodriguez-Medina JR, Garcia-Blanco MA, Hillyer GV. Fasciola hepatica: Molecular cloning nucleotide sequence and expression of a gene encoding a polypeptide homologous to Schistosoma mansoni fatty acid binding protein. Exp Parasitol 1992:74; Becker MM, Kalinna BH, Waine GJ, McManus DP. Gene cloning, overproduction and purification of a functionally active cytoplasmic fatty acid-binding protein (Sj-FABPC) from the human blood fluke Schistosoma. Gene 1994;148:

41 35. Tendler M, Brito CA, Vilar MM, Serra-Freire N, Diogo C, Almeida MS, et al. ASchistosoma mansoni fatty acid-binding protein, Sm14, is the potential basis of a dual-purpose anti-helminth vaccine. Proc Natl Acad Sci USA 1996;93: SpenceHJ,MooreJ,BrassA,KennedyMW.AcDNAencoding repeating units of the ABA-1 allergen of Ascaris. Mol Biochem Parasitol 1993;57: Madsen P, Rasmussen H, Leffers H, Honore B, Celis J. Molecular cloning and expression of a novel keratinocyte protein (psoriasis-associated fatty acid-binding protein [PA-FAB]) that is highly up-regulated in psoriatic skin and that shares similarity to fatty acid-binding proteins. J Invest Dermatol 1992; 99: Eriksson TL, Johansson E, Whitley P, Schmidt M, Elsayed S, van Hage-Hamsten M. Cloning and characterisation of a group II allergen from the dust mite Tyrophagus putrescentiae. Eur J Biochem 1998;251: Olsson S, van Hage-Hamsten M. Allergens from house dust and storage mites: similarities and differences, with emphasis on the storage mite Lepidoglyphus destructor. Clin Exp Allergy 2000;30: Arlian LG, Geis DP, Vyszenski-Moher DL, Bernstein IL, Gallagher JS. Cross antigenic and allergenic properties of the house dust mite Dermatophagoides farinae and the storage mite Tyrophagus putrescentiae. J Allergy Clin Immunol 1984;74: JohanssonE,JohanssonSG,VanHage-HamstenM.Allergenic -32-

42 characterization of Acarus siro and Tyrophagus putrescentiae and their crossreactivity with Lepidoglyphus destructor and Dermatophagoides pteronyssinus. Clin Exp Allergy 1994;24: Sehon AH. Heterogeneity of allergenic extracts and of the antibody response in allergic patients. Dev Biol Stand 1975;29:

43 Abstract Analysis of Expressed sequence tags from Tyrophagus putrescentiae and allergenic characterization of Tyr p 13 Woo Kyung Kim Department of Medicine TheGraduateSchool,YonseiUniversity (Directed by Professor Kyu-Earn Kim) Storage mite is one of the important causes of allergic disorders. Fifteen allergenic components were demonstrated by SDS-PAGE and immunoblotting. so far only group 2 allergen, Tyr p 2, has been cloned and characterized from Tyrophagus putrescentiae. In this study, we tried to identify and characterize new allergens from T. putrescentiae, which is a dominant species of storage mites in Korea. Expressed sequence tags (ESTs) were analyzed to investigate the allergens of the storage mites. A clone with cdna sequence encoding a protein homologous to fatty acid binding protein, mite group 13 allergen, was identified, which was named Tyr p 13. The deduced amino acid sequence shows % identity with other mite group 13 allergens. -34-

44 The recombinant protein was expressed in Escherichia coli using pet 28b vector system and its allergenicity was investigated by ELISA. The recombinant allergen was reacted with 5/78 (6.41%) by T. putrescentiae-positive sera. It inhibited 40.9% of IgE binding to crude extract at an inhibitor concentration of 10 g/ml by inhibition ELISA using serum from a patient who showed the strongest reaction by ELISA In this study, Tyr p 13 was found to be minor allergens, however, it may be different in farmers, who were reported to have a high prevalence of storage mite sensitization. A novel allergen from T. putrescentiae has been identified and it may be used help more precise diagnosis. It could be helpful for more detailed characterization of storage mite allergy. ꠏꠏꠏꠏꠏꠏꠏꠏꠏꠏꠏꠏꠏꠏꠏꠏꠏꠏꠏꠏꠏꠏꠏꠏꠏꠏꠏꠏꠏꠏꠏꠏꠏꠏꠏꠏꠏꠏꠏꠏꠏꠏꠏꠏꠏꠏꠏꠏꠏꠏꠏꠏꠏꠏꠏꠏꠏꠏꠏꠏꠏꠏꠏꠏꠏꠏꠏꠏꠏꠏ Key Words : Allergen, ESTs, Tyrophagus putrescenti, rtyr p