Cisco pxGrid로 인증서 배포

Save this PDF as:
 WORD  PNG  TXT  JPG
Size: px
Start display at page:

Download "Cisco pxGrid로 인증서 배포"

Transcription

1 Cisco pxgrid 로인증서배포 CA(Certifice Authority) 서명 pxgrid 클라이언트및자체서명 ISE pxgrid 노드인증서

2 목차 이문서정보... 3 서론... 4 인증서컨피그레이션예... 5 자체서명 ISE pxgrid 노드인증서및 pxgrid 페르소나컨피그레이션... 5 pxgrid 클라이언트인증서컨피그레이션... 8 pxgrid 클라이언트및 ISE pxgrid 노드테스트 키저장소항목보기 문제해결 페이지

3 이문서정보 이문서에서는 CA 권한으로서명된인증서및 ISE pxgrid 노드의 ISE 를위한 ISE 자체서명인증서를사용하여 pxgrid 클라이언트를구성하는데필요한컨피그레이션단계에대해설명합니다. 이문서는 Cisco pxgrid 를구축하는 Cisco 현장엔지니어, 기술마케팅엔지니어, 파트너및고객을대상으로합니다. 또한 pxgrid 에대해잘알고있어야합니다. pxgrid 에대해잘모르는사용자는아래의 Configure_and_Test_Integrion_with_Cisco_pxGrid.pdf 를참조하십시오. Configure_and_Test_Integrion_with_Cisco_pxGrid.pdf Cisco 어카운트팀에서 pxgrid sdk 를받습니다. Cisco ISE(Identity Services Engine) 1.3 이설치된것을전제로합니다. OSX 를실행중인 MAC 은 pxgrid 클라이언트로사용됩니다. Linux OS 도사용할수있습니다. pxgrid 클라이언트에는 Oracle Java Development Kit 7 또는 8 이필요합니다. Deploying pxgrid with Certifices 시리즈에는다음과같은두가지다른문서가있습니다. ISE pxgrid 노드및 pxgrid 클라이언트에 CA 서명인증서사용 ISE pxgrid 노드및 ISE pxgrid 클라이언트에자체서명인증서사용 3 페이지

4 서론 이섹션에서는 ISE 독립형구축시 pxgrid 클라이언트및 ISE pxgrid 노드의 CA 서명인증서컨피그레이션에대해자세히다룹니다. 이경우 pxgrid 클라이언트에는 Entrus 같은퍼블릭 CA 에의해서명된인증서가포함될수있습니다. 사용자지정 pxgrid 템플릿은클라이언트인증 ( ) 및서버인증 ( ) 에모두 EKU(Enhanced Key Usage) ISO 정의 OID(object identifier) 가수반됩니다. ISE pxgrid 노드에는 ISE 트러스트된인증서저장소의자체서명 ISE ID 인증서가포함됩니다. Microsoft Enterprise CA 2008 R2 는 pxgrid 클라이언트의인증서에서명할수있는 CA 권한으로사용됩니다. Microsoft CA 권한의 CA 루트인증서는 ISE 트러스트된인증서저장소에추가됩니다. ISE 퍼블릭인증서는 pxgrid 클라이언트의키저장소에추가됩니다. pxgrid 클라이언트가 ISE pxgrid 노드에연결할경우두퍼블릭인증서모두성공적인 pxgrid 연결을위해 SASL(Simple Authenticion and Security Layer) 에트러스트됩니다. 다음다이어그램에는정보의인증서플로우가나와있습니다. 4 페이지

5 인증서컨피그레이션예 다음은이문서에사용된인증서예를나타냅니다. 자체서명 ISE pxgrid 노드인증서및 pxgrid 페르소나컨피그레이션 이예에서는 ISE 자체서명인증서를 ISE 트러스트된인증서저장소로가져옵니다. ISE ID 인증서가트러스트된인증서저장소에있으면 ISE 노드의 pxgrid 페르소나를활성화하고이를 Primary 노드로변경할수있습니다. 게시된노드는 pxgrid Services View 에표시됩니다. 1 단계자체서명 ISE ID 인증서를내보내고.pem 파일로저장합니다. Administrion->System->Certifices 를차례로누른다음 ISE identity cert->export( 퍼블릭키만 ) 를선택합니다. 5 페이지

6 2 단계저장된 ISE.pem 파일을 ISE 트러스트된인증서저장소로가져옵니다. Administrion->System->Certifices->Trusted Certifices->Browse 를차례로누른다음파일을업로드하고 Submit 을누릅니다. ISE 트러스트된인증서가져오기가표시됩니다. 6 페이지

7 3 단계 CA 루트인증서를다운로드하고 ISE 트러스트된인증서저장소에업로드한다음 ISE 커뮤니케이션에트러스트활성화를선택합니다. Administrion->System->Certifices->Trusted Certifices->Import 를차례로누른다음 CA 루트인증서를업로드합니다. 4 단계 ISE 에서 pxgrid 페르소나를활성화합니다. Administrion->System->Deployment->Enable pxgrid 를차례로누른다음역할을 Primary 로변경하고 Save 를누릅니다. 참고 : 역할을 Primary 로반드시변경해야하는것은아닙니다. 7 페이지

8 5 단계게시된서비스가시작되었는지확인합니다. Administrion->pxGrid Services 참고 : ISE 게시노드가표시되기전까지지연이발생할수있습니다. pxgrid 페르소나가활성화되기전에인증서를설치해야합니다. pxgrid 클라이언트인증서컨피그레이션 이섹션에서는 pxgrid 클라이언트자체인증서생성프로세스를단계별로살펴봅니다. 인증서퍼블릭 / 프라이빗키쌍이생성되면프라이빗키인 self2.key 에서 PKCS12 파일이생성됩니다. PKCS12 파일은 ID 키저장소인 self1.jks 로가져오기됩니다. 이 ID 키저장소및관련비밀번호는 pxgrid 스크립트의 keystorefilename 및 keystorepassword 역할을합니다. pxgrid 클라이언트인증서인 self2.cer 도 ID 키저장소에추가됩니다. ISE ID 인증서인 isemnt 는모두벌크세션다운로드에필요하며, CA 루트인증서는트러스트키저장소인 root.jks 에추가됩니다. 이트러스트키저장소및관련비밀번호는 pxgrid 스크립트의 truststorefilename 및 truststorepassword 역할을합니다. 1 단계 pxgrid 클라이언트에대한프라이빗키 ( 예 : self2.key) 를생성합니다. openssl genrsa -out self2.key 4096 Genering RSA prive key, 4096 bit long modulus e is (0x10001) 2 단계 CA 권한에대한 CSR( 예 : self2.csr) 요청을생성합니다. 챌린지비밀번호 ( 예 : cisco123) 를제공합니다. 8 페이지

9 openssl req -new -key self2.key -out self2.csr You are about to be asked to enter informion th will be incorpored into your certifice request. Wh you are about to enter is wh is called a Distinguished Name or a DN. There are quite a few fields but you can leave some blank For some fields there will be a default value, If you enter '.', the field will be left blank Country Name (2 letter code) [AU: Ste or Province Name (full name) [Some-Ste: Locality Name (eg, city) [: Organizion Name (eg, company) [Internet Widgits Pty Ltd: Organizional Unit Name (eg, section) [: Common Name (e.g. server FQDN or YOUR name) [: Address [: Please enter the following 'extra' tributes to be sent with your certifice request A challenge password [:cisco123 An optional company name [:Eppich,Inc Note: Keep the same password throughout this documnent, easier to maintain, and cut down on errors 3 단계 CA 권한은클라이언트인증및서버인증을위한 EKU(Enhanced Key Usage) ISO 정의 OID(object identifier) 가포함된사용자정의템플릿 ( 예 : pxgrid) 을사용하여사용자인증서를지원해야합니다. 참고 : pxgrid 템플릿은 CA 권한에서생성됩니다. 이는중복된사용자템플릿이며, Windows 2003 형식을사용하므로 Certifice Temple 드롭다운메뉴에해당템플릿이표시됩니다. EKU 클라이언트인증및서버인증이모두템플릿에추가되었습니다. 4 단계 pxgrid 클라이언트인증서 ( 예 : self2.cer) 의프라이빗키에서 pxgrid 클라이언트 pkcs12 파일 (self2.p12) 을생성합니다. 이는키저장소관리에사용됩니다. CA 루트파일 ( 예 : ca_root.cer) 을포함합니다. 9 페이지

10 openssl pkcs12 -export -out self2.p12 -inkey self2.key -in self2.cer -chain -CAfile ca_root.cer Enter Export Password: cisco123 Verifying - Enter Export Password: cisco123 Johns-MacBook-Pro:pxGridsdk jeppich$ 참고 : cisco123 은이문서전체에서사용되는비밀번호입니다. 5 단계 pxgrid 클라이언트 ID 키저장소 ( 예 : self2.jks) 를생성합니다. 이는 pxgrid 스크립트예에서 keystorefilename 및관련 keystorepassword 역할을합니다. keytool -importkeystore -srckeystore self2.p12 -destkeystore self2.jks -srcstoretype PKCS12 Enter destinion keystore password: cisco123 Re-enter new password: cisco123 Enter source keystore password: cisco123 Entry for alias 1 successfully imported. Import command completed: 1 entries successfully imported, 0 entries failed or cancelled 6 단계퍼블릭 ISE ID 인증서만 pxgrid 클라이언트로내보내며, 이는.pem 형식으로이루어집니다. 확장자가.pem 인파일의이름을더읽기쉽게변경할수있습니다. 이예에서파일의이름은 isemnt.pem 으로변경되었습니다. 7 단계.pem 파일을.der 형식으로변환합니다. openssl x509 -outform der -in isemnt.pem -out isemnt.der 8 단계 ISE ID 인증서를트러스트키저장소 ( 예 : root.jks) 에추가합니다. 이는 pxgrid 스크립트에사용된 truststorefilename 및관련 truststorepassword 가됩니다. 10 페이지

11 keytool -import -alias mnt -keystore root.jks -file isemnt.der Enter keystore password: cisco123 Re-enter new password: cisco123 Owner: CN=ise.lab6.com Issuer: CN=ise.lab6.com Serial number: f ec27e53c1dd64f46 Valid from: Sun Dec 07 17:46:29 PST 2014 until: Mon Dec 07 17:46:29 PST 2015 Certifice fingerprints: MD5: 04:7D:67:04:EC:D2:F5:BC:DC:79:4D:0A:FF:62:09:FD SHA1: 5A:7B:02:E4:07:A1:D2:0B:7D:A5:AE:83:27:3B:E7:33:33:30:1E:32 SHA256: C4:21:6C:6F:5B:06:F3:2C:D7:26:35:CB:BE:2B:1B:FF:0E:EE:09:91:F6:B6:54:0C:6F:63:CB:43:1F:77:F2:37 Signure algorithm name: SHA1withRSA Version: 3 Extensions: #1: ObjectId: Criticality=false BasicConstraints:[ CA:true PhLen: #2: ObjectId: Criticality=false ExtendedKeyUsages [ serverauth clientauth #3: ObjectId: Criticality=false KeyUsage [ DigitalSignure Key_Encipherment Key_Agreement Key_CertSign #4: ObjectId: Criticality=false NetscapeCertType [ SSL server #5: ObjectId: Criticality=false SubjectKeyIdentifier [ KeyIdentifier [ 0000: C4 F3 1A 9E 7B 1B 14 4F 51 9E A A AC...OQ...3.z. 0010: D4 u76. Trust this certifice? [no: yes Certifice was added to keystore Johns-MacBook-Pro:pxGridsdk jeppich$ 9 단계 pxgrid 클라이언트인증서를 ID 키저장소로가져옵니다. keytool -import -alias pxgridclient -keystore self2.jks -file self2.cer Enter keystore password: cisco123 Certifice already exists in keystore under alias <1> Do you still want to add it? [no: no Certifice was not added to keystroke 11 페이지

12 10 단계 CA 루트인증서를트러스트키저장소에추가합니다. 두인증서는모두트러스트키저장소에상주해야합니다. keytool -import -alias root -keystore root.jks -file ca_root.cer Enter keystore password: cisco123 Owner: CN=lab6-WIN-BG7GPQ053ID-CA, DC=lab6, DC=com Issuer: CN=lab6-WIN-BG7GPQ053ID-CA, DC=lab6, DC=com Serial number: 448a6d6486c91cb14c6888c127d16c4e Valid from: Thu Nov 13 17:47:06 PST 2014 until: Wed Nov 13 17:57:06 PST 2019 Certifice fingerprints: MD5: 41:10:8A:F5:36:76:79:9C:2C:00:03:47:55:F8:CF:7B SHA1: 9D:DA:06:AF:06:3F:8F:5E:84:C7:F4:58:50:95:03:22:64:48:96:9F SHA256: DB:28:50:D6:47:CA:C0:6A:E9:7B:87:B4:0E:9C:3A:C1:A2:61:EA:D1:29:8B:45:B4:76:4B:DA:2A:F1:D8:E0:A3 Signure algorithm name: SHA256withRSA Version: 3 Extensions: #1: ObjectId: Criticality=false 0000: #2: ObjectId: Criticality=true BasicConstraints:[ CA:true PhLen: #3: ObjectId: Criticality=false KeyUsage [ DigitalSignure Key_CertSign Crl_Sign #4: ObjectId: Criticality=false SubjectKeyIdentifier [ KeyIdentifier [ 0000: A9 C7 8E 26 9C F5 37 0A E6 5A D4 A &..7..Z.6& : 6A C8 79 2C j.y, Trust this certifice? [no: yes Certifice was added to keystore 11 단계 ID 키저장소 ( 예 : self2.jks) 및트러스트키저장소 ( 예 : root.jks) 를.../samples/bin 폴더에복사합니다. pxgrid 클라이언트및 ISE pxgrid 노드테스트 샘플 pxgrid 스크립트인 register.sh 및 session_download.sh 는 pxgrid 클라이언트연결및 pxgrid 등록을확인하기위해실행됩니다. 세션다운로드는 ISE MNT 인증서및 pxgrid 클라이언트에문제가없는지확인합니다. 12 페이지

13 1 단계 pxgrid 클라이언트등록./register.sh -keystorefilename self2.jks -keystorepassword cisco123 -truststorefilename root.jks - truststorepassword cisco123 -group Session -description test -hostname username JohnMACbook properties version=1.0.0 hostnames= username=johnmacbook descriptipon=test keystorefilename=self2.jks keystorepassword=cisco123 truststorefilename=root.jks truststorepassword=cisco registering... connecting... connected. done registering. connection closed 2 단계세션다운로드실행./session_download.sh -keystorefilename self2.jks -keystorepassword cisco123 -truststorefilename root.jks - truststorepassword cisco123 -hostname username JohnMACbook properties version=1.0.0 hostnames= username=johnmacbook keystorefilename=self2.jks keystorepassword=cisco123 truststorefilename=root.jks truststorepassword=cisco123 filter=null start=null end=null connecting... connected. starting Wed Dec 10 09:55:36 PST session (ip= , Audit Session Id=0A B006E1086, User Name=jeppich, AD User DNS Domain=lab6.com, AD Host DNS Domain=null, AD User NetBIOS Name=LAB6, AD Host NETBIOS Name=null, Calling stion id=00:0c:29:d1:8d:90, Session ste= STARTED, Epsstus=null, Security Group=null, Endpoint Profile=VMWare-Device, NAS IP= , NAS Port=GigabitEthernet1/0/15, RADIUSAVPairs=[ Acct-Session- Id= , Posture Stus=null, Posture Timestamp=, Session Last Upde Time=Wed Dec 10 08:27:59 PST 2014 )... ending : Wed Dec 10 09:55:36 PST downloaded 1 sessions in 100 milliseconds connection closed 13 페이지

14 키저장소항목보기 키저장소항목을확인하여 ID 및트러스트키저장소의트러스트된인증서항목을볼수있습니다. keytool -list -v -keystore self2.jks Enter keystore password: Keystore type: JKS Keystore provider: SUN Your keystore contains 2 entries Alias name: isecert Creion de: Dec 10, 2014 Entry type: trustedcertentry Owner: CN=ise.lab6.com Issuer: CN=ise.lab6.com Serial number: f ec27e53c1dd64f46 Valid from: Sun Dec 07 17:46:29 PST 2014 until: Mon Dec 07 17:46:29 PST 2015 Certifice fingerprints: MD5: 04:7D:67:04:EC:D2:F5:BC:DC:79:4D:0A:FF:62:09:FD SHA1: 5A:7B:02:E4:07:A1:D2:0B:7D:A5:AE:83:27:3B:E7:33:33:30:1E:32 SHA256: C4:21:6C:6F:5B:06:F3:2C:D7:26:35:CB:BE:2B:1B:FF:0E:EE:09:91:F6:B6:54:0C:6F:63:CB:43:1F:77:F2:37 Signure algorithm name: SHA1withRSA Version: 3 Extensions: #1: ObjectId: Criticality=false BasicConstraints:[ CA:true PhLen: #2: ObjectId: Criticality=false ExtendedKeyUsages [ serverauth clientauth #3: ObjectId: Criticality=false KeyUsage [ DigitalSignure Key_Encipherment Key_Agreement Key_CertSign #4: ObjectId: Criticality=false NetscapeCertType [ SSL server #5: ObjectId: Criticality=false SubjectKeyIdentifier [ KeyIdentifier [ 0000: C4 F3 1A 9E 7B 1B 14 4F 51 9E A A AC...OQ...3.z. 0010: D4 u76. ******************************************* ******************************************* 14 페이지

15 Alias name: 1 Creion de: Dec 10, 2014 Entry type: PriveKeyEntry Certifice chain length: 2 Certifice[1: Owner: O=Internet Widgits Pty Ltd, ST=Some-Ste, C=AU Issuer: CN=lab6-WIN-BG7GPQ053ID-CA, DC=lab6, DC=com Serial number: 6105dce a Valid from: Wed Dec 10 09:01:44 PST 2014 until: S Dec 10 09:11:44 PST 2016 Certifice fingerprints: MD5: 76:3E:43:48:A7:FD:2C:5B:A3:FD:76:3F:6E:DF:2D:B8 SHA1: A9:E4:66:D9:34:C6:62:67:2B:C0:AF:E1:68:83:EA:36:3D:2A:23:CC SHA256: 0E:D8:04:30:39:3E:0B:06:D5:3E:29:94:ED:C7:76:7A:5E:27:1C:14:CF:CD:1E:4D:10:AF:22:A7:54:E5:52:7B Signure algorithm name: SHA256withRSA Version: 3 Extensions: #1: ObjectId: Criticality=false 0000: E A F7 0D *.H : E A F7 0D *.H : B 0E A A * 0030: F7 0D H... #2: ObjectId: Criticality=false 0000: A B A : B A B : C 06 0A 2B : 37 0A #3: ObjectId: Criticality=false 0000: 30 2D B DC FD 1A 0-.% : 87 CB EB D 2D 86 E6 FC A y S : 5E 86 D1 B FC EF ^...#...@..d... #4: ObjectId: Criticality=false AuthorityInfoAccess [ [ accessmethod: caissuers accesslocion: URIName: ldap:///cn=lab6-win-bg7gpq053id- CA,CN=AIA,CN=Public%20Key%20Services,CN=Services,CN=Configurion,DC=lab6,DC=com?cACertifice?base?objectC lass=certificionauthority #5: ObjectId: Criticality=false AuthorityKeyIdentifier [ KeyIdentifier [ 0000: A9 C7 8E 26 9C F5 37 0A E6 5A D4 A &..7..Z.6& : 6A C8 79 2C j.y, #6: ObjectId: Criticality=false CRLDistributionPoints [ [DistributionPoint: [URIName: ldap:///cn=lab6-win-bg7gpq053id-ca,cn=win- BG7GPQ053ID,CN=CDP,CN=Public%20Key%20Services,CN=Services,CN=Configurion,DC=lab6,DC=com?certificeRevoca tionlist?base?objectclass=crldistributionpoint #7: ObjectId: Criticality=false CertificePolicies [ [CertificePolicyId: [ [ 15 페이지

16 #8: ObjectId: Criticality=false ExtendedKeyUsages [ serverauth clientauth protection #9: ObjectId: Criticality=true KeyUsage [ DigitalSignure Key_Encipherment #10: ObjectId: Criticality=false SubjectKeyIdentifier [ KeyIdentifier [ 0000: 36 E2 1A 09 D D C3 6A 18 C1 C4 EB AE B5 6...QrM.j : E E.H9N Certifice[2: Owner: CN=lab6-WIN-BG7GPQ053ID-CA, DC=lab6, DC=com Issuer: CN=lab6-WIN-BG7GPQ053ID-CA, DC=lab6, DC=com Serial number: 448a6d6486c91cb14c6888c127d16c4e Valid from: Thu Nov 13 17:47:06 PST 2014 until: Wed Nov 13 17:57:06 PST 2019 Certifice fingerprints: MD5: 41:10:8A:F5:36:76:79:9C:2C:00:03:47:55:F8:CF:7B SHA1: 9D:DA:06:AF:06:3F:8F:5E:84:C7:F4:58:50:95:03:22:64:48:96:9F SHA256: DB:28:50:D6:47:CA:C0:6A:E9:7B:87:B4:0E:9C:3A:C1:A2:61:EA:D1:29:8B:45:B4:76:4B:DA:2A:F1:D8:E0:A3 Signure algorithm name: SHA256withRSA Version: 3 Extensions: #1: ObjectId: Criticality=false 0000: #2: ObjectId: Criticality=true BasicConstraints:[ CA:true PhLen: #3: ObjectId: Criticality=false KeyUsage [ DigitalSignure Key_CertSign Crl_Sign #4: ObjectId: Criticality=false SubjectKeyIdentifier [ KeyIdentifier [ 0000: A9 C7 8E 26 9C F5 37 0A E6 5A D4 A &..7..Z.6& : 6A C8 79 2C j.y, ******************************************* ******************************************* keytool -list -v -keystore root.jks Enter keystore password: Keystore type: JKS 16 페이지

17 Keystore provider: SUN Your keystore contains 2 entries Alias name: root Creion de: Dec 10, 2014 Entry type: trustedcertentry Owner: CN=lab6-WIN-BG7GPQ053ID-CA, DC=lab6, DC=com Issuer: CN=lab6-WIN-BG7GPQ053ID-CA, DC=lab6, DC=com Serial number: 448a6d6486c91cb14c6888c127d16c4e Valid from: Thu Nov 13 17:47:06 PST 2014 until: Wed Nov 13 17:57:06 PST 2019 Certifice fingerprints: MD5: 41:10:8A:F5:36:76:79:9C:2C:00:03:47:55:F8:CF:7B SHA1: 9D:DA:06:AF:06:3F:8F:5E:84:C7:F4:58:50:95:03:22:64:48:96:9F SHA256: DB:28:50:D6:47:CA:C0:6A:E9:7B:87:B4:0E:9C:3A:C1:A2:61:EA:D1:29:8B:45:B4:76:4B:DA:2A:F1:D8:E0:A3 Signure algorithm name: SHA256withRSA Version: 3 Extensions: #1: ObjectId: Criticality=false 0000: #2: ObjectId: Criticality=true BasicConstraints:[ CA:true PhLen: #3: ObjectId: Criticality=false KeyUsage [ DigitalSignure Key_CertSign Crl_Sign #4: ObjectId: Criticality=false SubjectKeyIdentifier [ KeyIdentifier [ 0000: A9 C7 8E 26 9C F5 37 0A E6 5A D4 A &..7..Z.6& : 6A C8 79 2C j.y, ******************************************* ******************************************* Alias name: mnt Creion de: Dec 10, 2014 Entry type: trustedcertentry Owner: CN=ise.lab6.com Issuer: CN=ise.lab6.com Serial number: f ec27e53c1dd64f46 Valid from: Sun Dec 07 17:46:29 PST 2014 until: Mon Dec 07 17:46:29 PST 2015 Certifice fingerprints: MD5: 04:7D:67:04:EC:D2:F5:BC:DC:79:4D:0A:FF:62:09:FD SHA1: 5A:7B:02:E4:07:A1:D2:0B:7D:A5:AE:83:27:3B:E7:33:33:30:1E:32 SHA256: C4:21:6C:6F:5B:06:F3:2C:D7:26:35:CB:BE:2B:1B:FF:0E:EE:09:91:F6:B6:54:0C:6F:63:CB:43:1F:77:F2:37 Signure algorithm name: SHA1withRSA Version: 3 Extensions: 17 페이지

18 #1: ObjectId: Criticality=false BasicConstraints:[ CA:true PhLen: #2: ObjectId: Criticality=false ExtendedKeyUsages [ serverauth clientauth #3: ObjectId: Criticality=false KeyUsage [ DigitalSignure Key_Encipherment Key_Agreement Key_CertSign #4: ObjectId: Criticality=false NetscapeCertType [ SSL server #5: ObjectId: Criticality=false SubjectKeyIdentifier [ KeyIdentifier [ 0000: C4 F3 1A 9E 7B 1B 14 4F 51 9E A A AC...OQ...3.z. 0010: D4 u76. ******************************************* ******************************************* 문제해결 이섹션에서는트러블슈팅에대한정보를제공합니다. pxgrid 클라이언트호스트이름및 ISE pxgrid 가 DNS 를통해확인가능한지파악하여 pxgrid 스크립팅오류메시지를방지합니다. 트러스트저장소가변경되고유사한오류메시지가표시될경우, ISE VM 에서 ISE 애플리케이션을중지하고다시시작합니다. 18 페이지

19 ./register.sh -keystorefilename self1.jks -keysrepassword cisco123 -truststorefilename root1.jks - truststorepassword cisco123 -username pxgridclient -hostname group Session -description test properties version=1.0.0 hostnames= username=pxgridclient descriptipon=test1 keystorefilename=self1.jks keystorepassword=cisco123 truststorefilename=root1.jks truststorepassword=cisco registering... connecting... javax.net.ssl.sslhandshakeexception: Received fal alert: unknown_ca sun.security.ssl.alerts.getsslexception(alerts.java:192) sun.security.ssl.alerts.getsslexception(alerts.java:154) sun.security.ssl.sslsocketimpl.recvalert(sslsocketimpl.java:1991) sun.security.ssl.sslsocketimpl.readrecord(sslsocketimpl.java:1104) sun.security.ssl.sslsocketimpl.performinitialhandshake(sslsocketimpl.java:1343) sun.security.ssl.sslsocketimpl.starthandshake(sslsocketimpl.java:1371) sun.security.ssl.sslsocketimpl.starthandshake(sslsocketimpl.java:1355) org.jivesoftware.smack.xmppconnection.proceedtlsreceived(xmppconnection.java:806) org.jivesoftware.smack.packetreader.parsepackets(packetreader.java:267) org.jivesoftware.smack.packetreader.access$000(packetreader.java:43) org.jivesoftware.smack.packetreader$1.run(packetreader.java:70) Exception in thread "main" com.cisco.pxgrid.gclexception: SASL authenticion failed: com.cisco.pxgrid.gridconnection.connect(gridconnection.java:197) com.cisco.pxgrid.samples.ise.register.main(register.java:99) Caused by: SASL authenticion failed: org.jivesoftware.smack.saslauthenticion.authentice(saslauthenticion.java:281) org.jivesoftware.smack.xmppconnection.login(xmppconnection.java:206) com.cisco.pxgrid.configurion.connect(configurion.java:194) com.cisco.pxgrid.gridconnection.connect(gridconnection.java:134)... 1 more ISE 서비스다시시작 applicion stop ise applicion start ise pxgrid 프로세스가초기화중인지확인합니다. sh applicion stus ise 유사한오류메시지가표시되면루트인증서를 truststorefilename 키저장소 ( 이예에서는 root3.jks) 에추가해야합니다../register.sh -keystorefilename pxgridclient.jks -keystorepassword cisco123 -truststorefilename root3.jks - truststorepassword cisco123 -group Session -description MACBOOK -username Macbook_PRO -hostname properties version=1.0.0 hostnames= username=macbook_pro descriptipon=macbook keystorefilename=pxgridclient.jks keystorepassword=cisco 페이지

20 truststorefilename=root3.jks truststorepassword=cisco registering... connecting... javax.net.ssl.sslhandshakeexception: java.security.cert.certificeexception: root certifice not trusted of [ise.lab6.com sun.security.ssl.alerts.getsslexception(alerts.java:192) sun.security.ssl.sslsocketimpl.fal(sslsocketimpl.java:1917) sun.security.ssl.handshaker.false(handshaker.java:301) sun.security.ssl.handshaker.false(handshaker.java:295) sun.security.ssl.clienthandshaker.servercertifice(clienthandshaker.java:1471) sun.security.ssl.clienthandshaker.processmessage(clienthandshaker.java:212) sun.security.ssl.handshaker.processloop(handshaker.java:936) sun.security.ssl.handshaker.process_record(handshaker.java:871) sun.security.ssl.sslsocketimpl.readrecord(sslsocketimpl.java:1043) sun.security.ssl.sslsocketimpl.performinitialhandshake(sslsocketimpl.java:1343) sun.security.ssl.sslsocketimpl.starthandshake(sslsocketimpl.java:1371) sun.security.ssl.sslsocketimpl.starthandshake(sslsocketimpl.java:1355) org.jivesoftware.smack.xmppconnection.proceedtlsreceived(xmppconnection.java:806) org.jivesoftware.smack.packetreader.parsepackets(packetreader.java:267) org.jivesoftware.smack.packetreader.access$000(packetreader.java:43) org.jivesoftware.smack.packetreader$1.run(packetreader.java:70) Caused by: java.security.cert.certificeexception: root certifice not trusted of [ise.lab6.com org.jivesoftware.smack.servertrustmanager.checkservertrusted(servertrustmanager.java:144) sun.security.ssl.abstracttrustmanagerwrapper.checkservertrusted(sslcontextimpl.java:865) sun.security.ssl.clienthandshaker.servercertifice(clienthandshaker.java:1453) more 아래와같은오류메시지가표시되면 pxgrid 클라이언트및 ISE pxgrid FQDN 이름이 DNS 를통해확인가능한지파악합니다../session_download.sh -keystorefilename jeppich.jks -keystorepassword cisco123 -truststorefilename trust007.jks -truststorepassword cisco123 -hostname username mac properties version=1.0.0 hostnames= username=mac2 keystorefilename=jeppich.jks keystorepassword=cisco123 truststorefilename=trust007.jks truststorepassword=cisco123 filter=null start=null end=null connecting... connected. 20:18: [main WARN o.a.cxf.phase.phaseinterceptorchain - Interceptor for { has thrown exception, unwinding now org.apache.cxf.interceptor.fault: Could not send Message. org.apache.cxf.interceptor.messagesenderinterceptor$messagesenderendinginterceptor.handlemessage(messagesen derinterceptor.java:64) ~[cxf-api jar:2.7.3 org.apache.cxf.phase.phaseinterceptorchain.dointercept(phaseinterceptorchain.java:271) ~[cxfapi jar:2.7.3 org.apache.cxf.jaxrs.client.abstractclient.doruninterceptorchain(abstractclient.java:581) [cxfrt-frontend-jaxrs jar:2.7.3 org.apache.cxf.jaxrs.client.webclient.dochainedinvocion(webclient.java:904) [cxf-rt-frontendjaxrs jar:2.7.3 org.apache.cxf.jaxrs.client.webclient.doinvoke(webclient.java:772) [cxf-rt-frontend-jaxrs jar:2.7.3 org.apache.cxf.jaxrs.client.webclient.doinvoke(webclient.java:759) [cxf-rt-frontend-jaxrs jar: 페이지

21 org.apache.cxf.jaxrs.client.webclient.invoke(webclient.java:355) [cxf-rt-frontend-jaxrs jar:2.7.3 org.apache.cxf.jaxrs.client.webclient.post(webclient.java:381) [cxf-rt-frontend-jaxrs jar:2.7.3 com.cisco.pxgrid.stub.identity.impl.sessioniterorimpl.open(sessioniterorimpl.java:128) [pxgrid-identity-client-stub jar:1.0.0 com.cisco.pxgrid.samples.ise.sessiondownload.main(sessiondownload.java:132) [pxgrid-sdk jar:1.0.0 Caused by: java.net.unknownhostexception: UnknownHostException invoking ise.lab6.com sun.reflect.niveconstructoraccessorimpl.newinstance0(nive Method) ~[na:1.8.0_25 sun.reflect.niveconstructoraccessorimpl.newinstance(niveconstructoraccessorimpl.java:62) ~[na:1.8.0_25 sun.reflect.delegingconstructoraccessorimpl.newinstance(delegingconstructoraccessorimpl.java:45) ~[na:1.8.0_25 java.lang.reflect.constructor.newinstance(constructor.java:408) ~[na:1.8.0_25 org.apache.cxf.transport.http.httpconduit$wrappedoutputstream.mapexception(httpconduit.java:1338) ~[cxf-rttransports-http jar:2.7.3 org.apache.cxf.transport.http.httpconduit$wrappedoutputstream.close(httpconduit.java:1322) ~[cxf-rt-transports-http jar:2.7.3 org.apache.cxf.transport.abstractconduit.close(abstractconduit.java:56) ~[cxf-api jar:2.7.3 org.apache.cxf.transport.http.httpconduit.close(httpconduit.java:622) ~[cxf-rt-transports-http jar:2.7.3 org.apache.cxf.interceptor.messagesenderinterceptor$messagesenderendinginterceptor.handlemessage(messagesen derinterceptor.java:62) ~[cxf-api jar: common frames omitted Caused by: java.net.unknownhostexception: ise.lab6.com java.net.abstractplainsocketimpl.connect(abstractplainsocketimpl.java:184) ~[na:1.8.0_25 java.net.sockssocketimpl.connect(sockssocketimpl.java:392) ~[na:1.8.0_25 java.net.socket.connect(socket.java:589) ~[na:1.8.0_25 sun.security.ssl.sslsocketimpl.connect(sslsocketimpl.java:649) ~[na:1.8.0_25 sun.net.networkclient.doconnect(networkclient.java:175) ~[na:1.8.0_25 sun.net. ~[na:1.8.0_25 sun.net. ~[na:1.8.0_25 sun.net. ~[na:1.8.0_25 sun.net. ~[na:1.8.0_25 sun.net. ection.java:191) ~[na:1.8.0_25 sun.net. ~[na:1.8.0_25 sun.net. ~[na:1.8.0_25 sun.net. va:177) ~[na:1.8.0_25 sun.net. ~[na:1.8.0_25 sun.net. ~[na:1.8.0_25 sun.net. ~[na:1.8.0_25 org.apache.cxf.transport.http.urlconnectionhttpconduit$urlconnectionwrappedoutputstream.setupwrappedstream( URLConnectionHTTPConduit.java:170) ~[cxf-rt-transports-http jar:2.7.3 org.apache.cxf.transport.http.httpconduit$wrappedoutputstream.handleheaderstrustcaching(httpconduit.java:12 82) ~[cxf-rt-transports-http jar:2.7.3 org.apache.cxf.transport.http.httpconduit$wrappedoutputstream.onfirstwrite(httpconduit.java:1233) ~[cxf-rttransports-http jar: 페이지

22 org.apache.cxf.transport.http.urlconnectionhttpconduit$urlconnectionwrappedoutputstream.onfirstwrite(urlcon nectionhttpconduit.java:183) ~[cxf-rt-transports-http jar:2.7.3 org.apache.cxf.io.abstractwrappedoutputstream.write(abstractwrappedoutputstream.java:47) ~[cxfapi jar:2.7.3 org.apache.cxf.io.abstractthresholdoutputstream.write(abstractthresholdoutputstream.java:69) ~[cxf-api jar:2.7.3 org.apache.cxf.transport.http.httpconduit$wrappedoutputstream.close(httpconduit.java:1295) ~[cxf-rt-transports-http jar: common frames omitted 20:18: [main WARN c.c.p.s.i.impl.sessioniterorimpl - unsuccessful tempt made to session directory ise.lab6.com javax.ws.rs.client.clientexception: javax.ws.rs.client.clientexception: org.apache.cxf.interceptor.fault: Could not send Message. org.apache.cxf.jaxrs.client.webclient.doresponse(webclient.java:946) ~[cxf-rt-frontend-jaxrs jar:2.7.3 org.apache.cxf.jaxrs.client.webclient.dochainedinvocion(webclient.java:905) ~[cxf-rt-frontendjaxrs jar:2.7.3 org.apache.cxf.jaxrs.client.webclient.doinvoke(webclient.java:772) ~[cxf-rt-frontend-jaxrs jar:2.7.3 org.apache.cxf.jaxrs.client.webclient.doinvoke(webclient.java:759) ~[cxf-rt-frontend-jaxrs jar:2.7.3 org.apache.cxf.jaxrs.client.webclient.invoke(webclient.java:355) ~[cxf-rt-frontend-jaxrs jar:2.7.3 org.apache.cxf.jaxrs.client.webclient.post(webclient.java:381) ~[cxf-rt-frontend-jaxrs jar:2.7.3 com.cisco.pxgrid.stub.identity.impl.sessioniterorimpl.open(sessioniterorimpl.java:128) ~[pxgrid-identity-client-stub jar:1.0.0 com.cisco.pxgrid.samples.ise.sessiondownload.main(sessiondownload.java:132) [pxgrid-sdk jar:1.0.0 Caused by: javax.ws.rs.client.clientexception: org.apache.cxf.interceptor.fault: Could not send Message. org.apache.cxf.jaxrs.client.abstractclient.checkclientexception(abstractclient.java:522) ~[cxfrt-frontend-jaxrs jar:2.7.3 org.apache.cxf.jaxrs.client.abstractclient.preprocessresult(abstractclient.java:508) ~[cxf-rtfrontend-jaxrs jar:2.7.3 org.apache.cxf.jaxrs.client.webclient.doresponse(webclient.java:941) ~[cxf-rt-frontend-jaxrs jar: common frames omitted Caused by: org.apache.cxf.interceptor.fault: Could not send Message. org.apache.cxf.interceptor.messagesenderinterceptor$messagesenderendinginterceptor.handlemessage(messagesen derinterceptor.java:64) ~[cxf-api jar:2.7.3 org.apache.cxf.phase.phaseinterceptorchain.dointercept(phaseinterceptorchain.java:271) ~[cxfapi jar:2.7.3 org.apache.cxf.jaxrs.client.abstractclient.doruninterceptorchain(abstractclient.java:581) ~[cxfrt-frontend-jaxrs jar:2.7.3 org.apache.cxf.jaxrs.client.webclient.dochainedinvocion(webclient.java:904) ~[cxf-rt-frontendjaxrs jar: common frames omitted Caused by: java.net.unknownhostexception: UnknownHostException invoking ise.lab6.com sun.reflect.niveconstructoraccessorimpl.newinstance0(nive Method) ~[na:1.8.0_25 sun.reflect.niveconstructoraccessorimpl.newinstance(niveconstructoraccessorimpl.java:62) ~[na:1.8.0_25 sun.reflect.delegingconstructoraccessorimpl.newinstance(delegingconstructoraccessorimpl.java:45) ~[na:1.8.0_25 java.lang.reflect.constructor.newinstance(constructor.java:408) ~[na:1.8.0_25 org.apache.cxf.transport.http.httpconduit$wrappedoutputstream.mapexception(httpconduit.java:1338) ~[cxf-rttransports-http jar:2.7.3 org.apache.cxf.transport.http.httpconduit$wrappedoutputstream.close(httpconduit.java:1322) ~[cxf-rt-transports-http jar:2.7.3 org.apache.cxf.transport.abstractconduit.close(abstractconduit.java:56) ~[cxf-api jar:2.7.3 org.apache.cxf.transport.http.httpconduit.close(httpconduit.java:622) ~[cxf-rt-transports-http jar: 페이지

23 org.apache.cxf.interceptor.messagesenderinterceptor$messagesenderendinginterceptor.handlemessage(messagesen derinterceptor.java:62) ~[cxf-api jar: common frames omitted Caused by: java.net.unknownhostexception: ise.lab6.com java.net.abstractplainsocketimpl.connect(abstractplainsocketimpl.java:184) ~[na:1.8.0_25 java.net.sockssocketimpl.connect(sockssocketimpl.java:392) ~[na:1.8.0_25 java.net.socket.connect(socket.java:589) ~[na:1.8.0_25 sun.security.ssl.sslsocketimpl.connect(sslsocketimpl.java:649) ~[na:1.8.0_25 sun.net.networkclient.doconnect(networkclient.java:175) ~[na:1.8.0_25 sun.net. ~[na:1.8.0_25 sun.net. ~[na:1.8.0_25 sun.net. ~[na:1.8.0_25 sun.net. ~[na:1.8.0_25 sun.net. ection.java:191) ~[na:1.8.0_25 sun.net. ~[na:1.8.0_25 sun.net. ~[na:1.8.0_25 sun.net. va:177) ~[na:1.8.0_25 sun.net. ~[na:1.8.0_25 sun.net. ~[na:1.8.0_25 sun.net. ~[na:1.8.0_25 org.apache.cxf.transport.http.urlconnectionhttpconduit$urlconnectionwrappedoutputstream.setupwrappedstream( URLConnectionHTTPConduit.java:170) ~[cxf-rt-transports-http jar:2.7.3 org.apache.cxf.transport.http.httpconduit$wrappedoutputstream.handleheaderstrustcaching(httpconduit.java:12 82) ~[cxf-rt-transports-http jar:2.7.3 org.apache.cxf.transport.http.httpconduit$wrappedoutputstream.onfirstwrite(httpconduit.java:1233) ~[cxf-rttransports-http jar:2.7.3 org.apache.cxf.transport.http.urlconnectionhttpconduit$urlconnectionwrappedoutputstream.onfirstwrite(urlcon nectionhttpconduit.java:183) ~[cxf-rt-transports-http jar:2.7.3 org.apache.cxf.io.abstractwrappedoutputstream.write(abstractwrappedoutputstream.java:47) ~[cxfapi jar:2.7.3 org.apache.cxf.io.abstractthresholdoutputstream.write(abstractthresholdoutputstream.java:69) ~[cxf-api jar:2.7.3 org.apache.cxf.transport.http.httpconduit$wrappedoutputstream.close(httpconduit.java:1295) ~[cxf-rt-transports-http jar: common frames omitted Exception in thread "main" java.io.ioexception: unsuccessful tempts made to all session directories com.cisco.pxgrid.stub.identity.impl.sessioniterorimpl.open(sessioniterorimpl.java:148) com.cisco.pxgrid.samples.ise.sessiondownload.main(sessiondownload.java:132) 23 페이지

Cisco pxGrid로 인증서 배포

Cisco pxGrid로 인증서 배포 Cisco pxgrid 로인증서배포 ISE pxgrid 노드및 pxgrid 클라이언트에자체서명인증서사용 목차 이문서정보... 3 서론... 4 인증서컨피그레이션예... 5 자체서명 ISE pxgrid 노드인증서및 pxgrid 페르소나컨피그레이션... 5 자체서명 pxgrid 클라이언트인증서... 8 pxgrid 클라이언트및 ISE pxgrid 노드테스트...

More information

ISE 분산 환경에서 pxGrid 구성 초안

ISE 분산 환경에서 pxGrid 구성 초안 ISE 분산환경에서 pxgrid 구성 초안 목차 이문서정보... 4 소개... 5 pxgrid 페르소나로 ISE 분산구축소개... 6 pxgrid 페르소나컨피그레이션... 8 Microsoft CA 2008 R2 Enterprise pxgrid 템플릿구성... 8 pxgrid 액티브-스탠바이없이 pxgrid 노드컨피그레이션... 10 CA 서명노드인증서생성...

More information

2. 개인키권한설정 보안경고개인키의유출방지를위해 group 과 other 의 permission 을모두제거한다. chmod 600 /etc/pki/tls/private/lesstif-rootca.key 3. CSR(Certificate Signing Request) 생

2. 개인키권한설정 보안경고개인키의유출방지를위해 group 과 other 의 permission 을모두제거한다. chmod 600 /etc/pki/tls/private/lesstif-rootca.key 3. CSR(Certificate Signing Request) 생 OpenSSL 로 ROOT CA 생성및 SSL 인증서발급 개요 Self Signed Certificate(SSC) 란? CSR(Certificate Signing Request) 은? ROOT CA 인증서생성 SSL 인증서생성 apache httpd 에 SSL 적용같이보기 개요 웹서비스에 https 를적용할경우 SSL 인증서를 VeriSign 이나 Thawte,

More information

정적으로 설치된 mod_ssl 모듈확인 동적으로 설치된 mod_ssl 모듈확인 웹서버에 설치된 모듈중 mod_so.c 를 먼저 확인후 동적으로 설치된 모듈중 mod_ssl.so 를 확인합니다. 동적으로 설치된 경우 apache 설치 디렉토리의 module 이나 libe

정적으로 설치된 mod_ssl 모듈확인 동적으로 설치된 mod_ssl 모듈확인 웹서버에 설치된 모듈중 mod_so.c 를 먼저 확인후 동적으로 설치된 모듈중 mod_ssl.so 를 확인합니다. 동적으로 설치된 경우 apache 설치 디렉토리의 module 이나 libe Apache 설치방법 보기 Apache 웹서버에 SSL를 적용하기 위해 아래 두 항목이 웹서버에 설치되어 있어야 합니다. Openssl 암호화 라이브러리 Mod_ssl 모듈 위 두 항목이 웹서버에 설치되어 있다면 개인키를 생성하고 생성된 개인키를 바탕으로 CSR 파일을 생성합니다. 생성된 CSR 파일을 한비로에 접수하여 정식 인증서를 발급받습니다. 발급된 인증서를

More information

RHEV 2.2 인증서 만료 확인 및 갱신

RHEV 2.2 인증서 만료 확인 및 갱신 2018/09/28 03:56 1/2 목차... 1 인증서 확인... 1 인증서 종류와 확인... 4 RHEVM CA... 5 FQDN 개인 인증서... 5 레드햇 인증서 - 코드 서명 인증서... 6 호스트 인증... 7 참고사항... 8 관련링크... 8 AllThatLinux! - http://allthatlinux.com/dokuwiki/ rhev_2.2_

More information

Tomcat.hwp

Tomcat.hwp Tomcat Web Server SSL 설정방법 - Ver 1.0-2008. 6 개정이력 버전개정일개정내용 Ver 1.0 2008 년 6 월 Tomcat Web Server SSL 설명서최초작성 본문서는정보통신부 한국정보보호진흥원의 보안서버구축가이드 를참고하여작성되었습니다. 본문서내용의무단도용및사용을금합니다. < 목차 > 1. 개인키및 CSR 생성방법 1 2.

More information

yessign Version 3.1 (yessign). ccopyright 2009 yessign ALL RIGHTS RESERVED

yessign Version 3.1 (yessign). ccopyright 2009 yessign ALL RIGHTS RESERVED yessign Version 3.1 (yessign). ccopyright 2009 yessign ALL RIGHTS RESERVED - - 2000. 8.29. 2000. 8.29. 2001. 7. 5. 2001. 7. 5. 2001.12.17. 2001.12.17. 2002. 3.12. 2002. 3.12. 2002. 8.21. 2002. 9. 5. 2002.12.27.

More information

- - yessign Version 3.5 (yessign)

- - yessign Version 3.5 (yessign) - - yessign Version 3.5 (yessign). 2000. 8.29. 2000. 8.29. 2001. 7. 5. 2001. 7. 5. 2001.12.17. 2001.12.17. 2002. 3.12. 2002. 3.12. 2002. 8.21. 2002. 9. 5. 2002.12.27. 2003. 1.13. 2004. 3.31. 2004. 6.12.

More information

Analytics > Log & Crash Search > Unity ios SDK [Deprecated] Log & Crash Unity ios SDK. TOAST SDK. Log & Crash Unity SDK Log & Crash Search. Log & Cras

Analytics > Log & Crash Search > Unity ios SDK [Deprecated] Log & Crash Unity ios SDK. TOAST SDK. Log & Crash Unity SDK Log & Crash Search. Log & Cras Analytics > Log & Crash Search > Unity ios SDK [Deprecated] Log & Crash Unity ios SDK. TOAST SDK. Log & Crash Unity SDK Log & Crash Search. Log & Crash Unity SDK... Log & Crash Search. - Unity3D v4.0 ios

More information

Remote UI Guide

Remote UI Guide Remote UI KOR Remote UI Remote UI PDF Adobe Reader/Adobe Acrobat Reader. Adobe Reader/Adobe Acrobat Reader Adobe Systems Incorporated.. Canon. Remote UI GIF Adobe Systems Incorporated Photoshop. ..........................................................

More information

PWR PWR HDD HDD USB USB Quick Network Setup Guide xdsl/cable Modem PC DVR 1~3 1.. DVR DVR IP xdsl Cable xdsl Cable PC PC DDNS (

PWR PWR HDD HDD USB USB Quick Network Setup Guide xdsl/cable Modem PC DVR 1~3 1.. DVR DVR IP xdsl Cable xdsl Cable PC PC DDNS ( PWR PWR HDD HDD USB USB Quick Network Setup Guide xdsl/cable Modem PC DVR 1~3 1.. DVR DVR IP xdsl Cable xdsl Cable PC PC DDNS (http://ddns.hanwha-security.com) Step 1~5. Step, PC, DVR Step 1. Cable Step

More information

휠세미나3 ver0.4

휠세미나3 ver0.4 andromeda@sparcs:/$ ls -al dev/sda* brw-rw---- 1 root disk 8, 0 2014-06-09 18:43 dev/sda brw-rw---- 1 root disk 8, 1 2014-06-09 18:43 dev/sda1 brw-rw---- 1 root disk 8, 2 2014-06-09 18:43 dev/sda2 andromeda@sparcs:/$

More information

Solaris Express Developer Edition

Solaris Express Developer Edition Solaris Express Developer Edition : 2008 1 Solaris TM Express Developer Edition Solaris OS. Sun / Solaris, Java, Web 2.0,,. Developer Solaris Express Developer Edition System Requirements. 768MB. SPARC

More information

Sena Device Server Serial/IP TM Version

Sena Device Server Serial/IP TM Version Sena Device Server Serial/IP TM Version 1.0.0 2005. 3. 7. Release Note Revision Date Name Description V1.0.0 2005-03-7 HJ Jeon Serial/IP 4.3.2 ( ) 210 137-130, : (02) 573-5422 : (02) 573-7710 email: support@sena.com

More information

WebtoB.hwp

WebtoB.hwp WebtoB Web Server SSL 설정방법 - Ver 1.0-2008. 6 개정이력 버전개정일개정내용 Ver 1.0 2008 년 6 월 WebtoB Web Server SSL 설명서최초작성 본문서는정보통신부 한국정보보호진흥원의 보안서버구축가이드 를참고하여작성되었습니다. 본문서내용의무단도용및사용을금합니다. < 목차 > 1. 개인키및 CSR 생성방법 4 2.

More information

Microsoft PowerPoint - 11주차_Android_GoogleMap.ppt [호환 모드]

Microsoft PowerPoint - 11주차_Android_GoogleMap.ppt [호환 모드] Google Map View 구현 학습목표 교육목표 Google Map View 구현 Google Map 지원 Emulator 생성 Google Map API Key 위도 / 경도구하기 위도 / 경도에따른 Google Map View 구현 Zoom Controller 구현 Google Map View (1) () Google g Map View 기능 Google

More information

USB USB DV25 DV25 REC SRN-475S REC SRN-475S LAN POWER LAN POWER Quick Network Setup Guide xdsl/cable Modem PC DVR 1~3 1.. DVR DVR IP xdsl Cable xdsl C

USB USB DV25 DV25 REC SRN-475S REC SRN-475S LAN POWER LAN POWER Quick Network Setup Guide xdsl/cable Modem PC DVR 1~3 1.. DVR DVR IP xdsl Cable xdsl C USB USB DV25 DV25 REC SRN-475S REC SRN-475S LAN POWER LAN POWER Quick Network Setup Guide xdsl/cable Modem PC DVR 1~3 1.. DVR DVR IP xdsl Cable xdsl Cable PC PC Step 1~5. Step, PC, DVR Step 1. Cable Step

More information

BEA_WebLogic.hwp

BEA_WebLogic.hwp BEA WebLogic Server SSL 설정방법 - Ver 1.0-2008. 6 개정이력 버전개정일개정내용 Ver 1.0 2008 년 6 월 BEA WebLogic Server SSL 설명서최초작성 본문서는정보통신부 한국정보보호진흥원의 보안서버구축가이드 를참고하여작성되었습니다. 본문서내용의무단도용및사용을금합니다. < 목차 > 1. 개인키및 CSR 생성방법

More information

- 1 - 1.. SSL SSL PC (S/W) PC. SSL., SSL. 웹상에서송 수신되는개인정보의대표적예시 1 웹사이트로그인시 ID/ 패스워드 2 웹사이트회원가입시이름 / 주민등록번호 / 전화번호 3 인터넷뱅킹이용시계좌번호 / 계좌비밀번호등 2. 1) (sniffing) (, PC, ) PC, (sniffing tool).. 2) (Phishing) (phishing).

More information

IRISCard Anywhere 5

IRISCard Anywhere 5 이 빠른 사용자 가이드는 IRISCard Anywhere 5 및 IRISCard Corporate 5 스캐너의 설치와 시작을 도와 드립니다. 이 스캐너와 함께 제공되는 소프트웨어는: - Cardiris Pro 5 및 Cardiris Corporate 5 for CRM (Windows 용) - Cardiris Pro 4 (Mac OS 용) Cardiris 의

More information

Assign an IP Address and Access the Video Stream - Installation Guide

Assign an IP Address and Access the Video Stream - Installation Guide 설치 안내서 IP 주소 할당 및 비디오 스트림에 액세스 책임 본 문서는 최대한 주의를 기울여 작성되었습니다. 잘못되거나 누락된 정보가 있는 경우 엑시스 지사로 알려 주시기 바랍니다. Axis Communications AB는 기술적 또는 인쇄상의 오류에 대해 책 임을 지지 않으며 사전 통지 없이 제품 및 설명서를 변경할 수 있습니다. Axis Communications

More information

10X56_NWG_KOR.indd

10X56_NWG_KOR.indd 디지털 프로젝터 X56 네트워크 가이드 이 제품을 구입해 주셔서 감사합니다. 본 설명서는 네트워크 기능 만을 설명하기 위한 것입니다. 본 제품을 올바르게 사 용하려면 이 취급절명저와 본 제품의 다른 취급절명저를 참조하시기 바랍니다. 중요한 주의사항 이 제품을 사용하기 전에 먼저 이 제품에 대한 모든 설명서를 잘 읽어 보십시오. 읽은 뒤에는 나중에 필요할 때

More information

Cisco FirePOWER 호환성 가이드

Cisco FirePOWER 호환성 가이드 Cisco 호환성가이드 Cisco 호환성 이문서에서는 Cisco 소프트웨어와하드웨어의호환성및요건을다룹니다. 추가 릴리스또는제품정보는다음을참조하십시오. 설명서로드맵 : http://www.cisco.com/c/en/us/td/docs/security/firesight/ roadmap/firesight-roadmap.html Cisco ASA 호환성가이드 : http://www.cisco.com/c/en/us/td/docs/security/asa/compatibility/

More information

untitled

untitled Push... 2 Push... 4 Push... 5 Push... 13 Push... 15 1 FORCS Co., LTD A Leader of Enterprise e-business Solution Push (Daemon ), Push Push Observer. Push., Observer. Session. Thread Thread. Observer ID.

More information

vRealize Automation용 VMware Remote Console - VMware

vRealize Automation용 VMware Remote Console - VMware vrealize Automation 용 VMware Remote Console VMware Remote Console 9.0 이문서는새버전으로교체되기전까지나열된각제품버전및모든이후버전을지원합니다. 이문서에대한최신버전을확인하려면 http://www.vmware.com/kr/support/pubs 를참조하십시오. KO-002230-00 vrealize Automation

More information

본교재는수업용으로제작된게시물입니다. 영리목적으로사용할경우저작권법제 30 조항에의거법적처벌을받을수있습니다. [ 실습 ] 스위치장비초기화 1. NVRAM 에저장되어있는 'startup-config' 파일이있다면, 삭제를실시한다. SWx>enable SWx#erase sta

본교재는수업용으로제작된게시물입니다. 영리목적으로사용할경우저작권법제 30 조항에의거법적처벌을받을수있습니다. [ 실습 ] 스위치장비초기화 1. NVRAM 에저장되어있는 'startup-config' 파일이있다면, 삭제를실시한다. SWx>enable SWx#erase sta [ 실습 ] 스위치장비초기화 1. NVRAM 에저장되어있는 'startup-config' 파일이있다면, 삭제를실시한다. SWx>enable SWx#erase startup-config Erasing the nvram filesystem will remove all configuration files Continue? [confirm] ( 엔터 ) [OK] Erase

More information

ORANGE FOR ORACLE V4.0 INSTALLATION GUIDE (Online Upgrade) ORANGE CONFIGURATION ADMIN O

ORANGE FOR ORACLE V4.0 INSTALLATION GUIDE (Online Upgrade) ORANGE CONFIGURATION ADMIN O Orange for ORACLE V4.0 Installation Guide ORANGE FOR ORACLE V4.0 INSTALLATION GUIDE...1 1....2 1.1...2 1.2...2 1.2.1...2 1.2.2 (Online Upgrade)...11 1.3 ORANGE CONFIGURATION ADMIN...12 1.3.1 Orange Configuration

More information

Windows 8에서 BioStar 1 설치하기

Windows 8에서 BioStar 1 설치하기 / 콘텐츠 테이블... PC에 BioStar 1 설치 방법... Microsoft SQL Server 2012 Express 설치하기... Running SQL 2012 Express Studio... DBSetup.exe 설정하기... BioStar 서버와 클라이언트 시작하기... 1 1 2 2 6 7 1/11 BioStar 1, Windows 8 BioStar

More information

API STORE 키발급및 API 사용가이드 Document Information 문서명 : API STORE 언어별 Client 사용가이드작성자 : 작성일 : 업무영역 : 버전 : 1 st Draft. 서브시스템 : 문서번호 : 단계 : Docum

API STORE 키발급및 API 사용가이드 Document Information 문서명 : API STORE 언어별 Client 사용가이드작성자 : 작성일 : 업무영역 : 버전 : 1 st Draft. 서브시스템 : 문서번호 : 단계 : Docum API STORE 키발급및 API 사용가이드 Document Information 문서명 : API STORE 언어별 Client 사용가이드작성자 : 작성일 : 2012.11.23 업무영역 : 버전 : 1 st Draft. 서브시스템 : 문서번호 : 단계 : Document Distribution Copy Number Name(Role, Title) Date

More information

Microsoft Word - ntasFrameBuilderInstallGuide2.5.doc

Microsoft Word - ntasFrameBuilderInstallGuide2.5.doc NTAS and FRAME BUILDER Install Guide NTAS and FRAME BUILDER Version 2.5 Copyright 2003 Ari System, Inc. All Rights reserved. NTAS and FRAME BUILDER are trademarks or registered trademarks of Ari System,

More information

SMB_ICMP_UDP(huichang).PDF

SMB_ICMP_UDP(huichang).PDF SMB(Server Message Block) UDP(User Datagram Protocol) ICMP(Internet Control Message Protocol) SMB (Server Message Block) SMB? : Microsoft IBM, Intel,. Unix NFS. SMB client/server. Client server request

More information

초기설정 WebtoB Web Server 에서인증서를사용하기위해 CSR 을생성하는방법입니다. 1. 초기설정 - CSR 을생성하기전에다음의몇가지사항을필히확인합니다. 부팅후 Path 나환경변수를일일이설정하지않게초기설정파일을사용하여로그인시자동으로실행되도록하고있습니다. 그러나

초기설정 WebtoB Web Server 에서인증서를사용하기위해 CSR 을생성하는방법입니다. 1. 초기설정 - CSR 을생성하기전에다음의몇가지사항을필히확인합니다. 부팅후 Path 나환경변수를일일이설정하지않게초기설정파일을사용하여로그인시자동으로실행되도록하고있습니다. 그러나 초기설정 WebtoB Web Server 에서인증서를사용하기위해 CSR 을생성하는방법입니다. 1. 초기설정 - CSR 을생성하기전에다음의몇가지사항을필히확인합니다. 부팅후 Path 나환경변수를일일이설정하지않게초기설정파일을사용하여로그인시자동으로실행되도록하고있습니다. 그러나간혹초기설정파일이실행되지않아서에러가생기는경우가있는데이럴경우에초기설정파일을다시한번실행시켜야합니다.

More information

4. CSR 값확인. (vi csr.pem) CSR(Certificate Signing Request) 즉, 인증서서명요청입니다. 이는자신이설치할웹서버에서 DN 값, 각종정보를암호화한파일로써 한국전자인증 신청란에서붙여넣으면됩니다. 인증서설치 1. 직접 CSR 및 KEY

4. CSR 값확인. (vi csr.pem) CSR(Certificate Signing Request) 즉, 인증서서명요청입니다. 이는자신이설치할웹서버에서 DN 값, 각종정보를암호화한파일로써 한국전자인증 신청란에서붙여넣으면됩니다. 인증서설치 1. 직접 CSR 및 KEY 키생성및 CSR 생성 키생성을위해 OpenSSL 설치디렉토리에서아래명령대로생성 1. 랜덤넘버생성 $ openssl md5 * > rand.dat 2. 키쌍생성 openssl genrsa -rand rand.cat -des3 1024 > key.pem 3. 생성된키쌍을이용하여 CSR 생성 openssl req -new -key key.pem > csr.pem

More information

chapter1,2.doc

chapter1,2.doc JavaServer Pages Version 08-alpha copyright2001 B l u e N o t e all rights reserved http://jspboolpaecom vesion08-alpha, UML (?) part1part2 Part1 part2 part1 JSP Chapter2 ( ) Part 1 chapter 1 JavaServer

More information

Copyright 2012, Oracle and/or its affiliates. All rights reserved.,,,,,,,,,,,,,.,..., U.S. GOVERNMENT END USERS. Oracle programs, including any operat

Copyright 2012, Oracle and/or its affiliates. All rights reserved.,,,,,,,,,,,,,.,..., U.S. GOVERNMENT END USERS. Oracle programs, including any operat Sun Server X3-2( Sun Fire X4170 M3) Oracle Solaris : E35482 01 2012 9 Copyright 2012, Oracle and/or its affiliates. All rights reserved.,,,,,,,,,,,,,.,..., U.S. GOVERNMENT END USERS. Oracle programs, including

More information

CD-RW_Advanced.PDF

CD-RW_Advanced.PDF HP CD-Writer Program User Guide - - Ver. 2.0 HP CD-RW Adaptec Easy CD Creator Copier, Direct CD. HP CD-RW,. Easy CD Creator 3.5C, Direct CD 3.0., HP. HP CD-RW TEAM ( 02-3270-0803 ) < > 1. CD...3 CD...5

More information

Chapter 1

Chapter 1 3 Oracle 설치 Objectives Download Oracle 11g Release 2 Install Oracle 11g Release 2 Download Oracle SQL Developer 4.0.3 Install Oracle SQL Developer 4.0.3 Create a database connection 2 Download Oracle 11g

More information

아래 항목은 최신( ) 이미지를 모두 제대로 설치하였을 때를 가정한다

아래 항목은 최신( ) 이미지를 모두 제대로 설치하였을 때를 가정한다 공유기사용환경에서 MNC-V100 환경설정하기 다음설명은 AnyGate GW-400A (Http://www.anygate.co.kr) 를사용하는네트워크환경에서 MNC-V100 을연결하여사용하는법을설명합니다. 공유기내부네트워크환경설정공유기를사용하는환경에서공유기의설정을아래그림과같이설정하시면 MNC-V100의설정을변경하지않아도모비캠과연결할수있습니다. ( 공유기의환경을변경하기어려운경우에는

More information

MasoJava4_Dongbin.PDF

MasoJava4_Dongbin.PDF JSTORM http://wwwjstormpekr Issued by: < > Revision: Document Information Document title: Document file name: MasoJava4_Dongbindoc Revision number: Issued by: < > SI, dbin@handysoftcokr

More information

SQL Developer Connect to TimesTen 유니원아이앤씨 DB 기술지원팀 2010 년 07 월 28 일 문서정보 프로젝트명 SQL Developer Connect to TimesTen 서브시스템명 버전 1.0 문서명 작성일 작성자

SQL Developer Connect to TimesTen 유니원아이앤씨 DB 기술지원팀 2010 년 07 월 28 일 문서정보 프로젝트명 SQL Developer Connect to TimesTen 서브시스템명 버전 1.0 문서명 작성일 작성자 SQL Developer Connect to TimesTen 유니원아이앤씨 DB 팀 2010 년 07 월 28 일 문서정보 프로젝트명 SQL Developer Connect to TimesTen 서브시스템명 버전 1.0 문서명 작성일 2010-07-28 작성자 김학준 최종수정일 2010-07-28 문서번호 20100728_01_khj 재개정이력 일자내용수정인버전

More information

Interstage5 SOAP서비스 설정 가이드

Interstage5 SOAP서비스 설정 가이드 Interstage 5 Application Server ( Solaris ) SOAP Service Internet Sample Test SOAP Server Application SOAP Client Application CORBA/SOAP Server Gateway CORBA/SOAP Gateway Client INTERSTAGE SOAP Service

More information

chapter4

chapter4 Basic Netw rk 1. ก ก ก 2. 3. ก ก 4. ก 2 1. 2. 3. 4. ก 5. ก 6. ก ก 7. ก 3 ก ก ก ก (Mainframe) ก ก ก ก (Terminal) ก ก ก ก ก ก ก ก 4 ก (Dumb Terminal) ก ก ก ก Mainframe ก CPU ก ก ก ก 5 ก ก ก ก ก ก ก ก ก ก

More information

Splentec V-WORM Quick Installation Guide Version: 1.0 Contact Information 올리브텍 주소 : 경기도성남시분당구구미로 11 ( 포인트타운 701호 ) URL: E-M

Splentec V-WORM Quick Installation Guide Version: 1.0 Contact Information 올리브텍 주소 : 경기도성남시분당구구미로 11 ( 포인트타운 701호 ) URL:   E-M Splentec V-WORM Quick Installation Guide Version: 1.0 Contact Information 올리브텍 주소 : 경기도성남시분당구구미로 11 ( 포인트타운 701호 ) URL: http://www.olivetech.co.kr E-Mail: tech@olivetech.co.kr TEL: 031-726-4217 FAX: 031-726-4219

More information

Tomcat 4.x 웹서버에 J2SE 를설치를확인합니다. java -version java version "1.4.2_05" Java(TM) 2 Runtime Environment, Standard Edition (build 1.4.2_05-b04) Java HotSp

Tomcat 4.x 웹서버에 J2SE 를설치를확인합니다. java -version java version 1.4.2_05 Java(TM) 2 Runtime Environment, Standard Edition (build 1.4.2_05-b04) Java HotSp Tomcat (4.x, 5.x 공통 ) CSR(Certificate Signing Request) 생성 Tomcat 4.x, 5.x 웹서버를사용하시는경우에는 SSL 환경설정이필요합니다. SSL 환경설정은 JSSE(Java Secure Socket Extension) 1.0.2 ( 또는이후버전 ) 패키지가웹서버에설치되어야합니다. 그리고 Tomcat 4.x, 5.x

More information

Sun Java System Messaging Server 63 64

Sun Java System Messaging Server 63 64 Sun Java System Messaging Server 6.3 64 Sun Java TM System Communications Suite Sun Microsystems, Inc. 4150 Network Circle Santa Clara, CA 95054 U.S.A. : 820 2868 2007 7 Copyright 2007 Sun Microsystems,

More information

Portal_9iAS.ppt [읽기 전용]

Portal_9iAS.ppt [읽기 전용] Application Server iplatform Oracle9 A P P L I C A T I O N S E R V E R i Oracle9i Application Server e-business Portal Client Database Server e-business Portals B2C, B2B, B2E, WebsiteX B2Me GUI ID B2C

More information

bn2019_2

bn2019_2 arp -a Packet Logging/Editing Decode Buffer Capture Driver Logging: permanent storage of packets for offline analysis Decode: packets must be decoded to human readable form. Buffer: packets must temporarily

More information

User Guide

User Guide HP Pocket Playlist 사용 설명서 부품 번호: 699916-AD2 제 2 판: 2013 년 1 월, 초판: 2012 년 12 월 Copyright 2012, 2013 Hewlett-Packard Development Company, L.P. Microsoft, Windows 및 Windows Vista 는 Microsoft Corporation

More information

교육2 ? 그림

교육2 ? 그림 Interstage 5 Apworks EJB Application Internet Revision History Edition Date Author Reviewed by Remarks 1 2002/10/11 2 2003/05/19 3 2003/06/18 EJB 4 2003/09/25 Apworks5.1 [ Stateless Session Bean ] ApworksJava,

More information

cam_IG.book

cam_IG.book 설치 안내서 AXIS P3301 고정형 돔 네트워크 카메라 AXIS P3301-V 고정형 돔 네트워크 카메라 한국어 AXIS P3304 고정형 돔 네트워크 카메라 AXIS P3304-V 고정형 돔 네트워크 카메라 문서 정보 본 문서에는 사용자 네트워크에 AXIS P3301/P3304 고정형 돔 네트워크 카메라를 설치하는 방법에 대 한 지침이 포함되어 있습니다.

More information

<32B1B3BDC32E687770>

<32B1B3BDC32E687770> 008년도 상반기 제회 한 국 어 능 력 시 험 The th Test of Proficiency in Korean 일반 한국어(S-TOPIK 중급(Intermediate A 교시 이해 ( 듣기, 읽기 수험번호(Registration No. 이 름 (Name 한국어(Korean 영 어(English 유 의 사 항 Information. 시험 시작 지시가 있을

More information

Analyst Briefing

Analyst Briefing . Improve your Outlook on Email and File Management iseminar.. 1544(or 6677)-3355 800x600. iseminar Chat... Improve your Outlook on Email and File Management :, 2003 1 29.. Collaboration Suite - Key Messages

More information

Network seminar.key

Network seminar.key Intro to Network .. 2 4 ( ) ( ). ?!? ~! This is ~ ( ) /,,,???? TCP/IP Application Layer Transfer Layer Internet Layer Data Link Layer Physical Layer OSI 7 TCP/IP Application Layer Transfer Layer 3 4 Network

More information

(SW3704) Gingerbread Source Build & Working Guide

(SW3704) Gingerbread Source Build & Working Guide (Mango-M32F4) Test Guide http://www.mangoboard.com/ http://cafe.naver.com/embeddedcrazyboys Crazy Embedded Laboratory www.mangoboard.com cafe.naver.com/embeddedcrazyboys CRZ Technology 1 Document History

More information

Install stm32cubemx and st-link utility

Install stm32cubemx and st-link utility STM32CubeMX and ST-LINK Utility for STM32 Development 본문서는 ST Microelectronics 의 ARM Cortex-M 시리즈 Microcontroller 개발을위해제공되는 STM32CubeMX 와 STM32 ST-LINK Utility 프로그램의설치과정을설명합니다. 본문서는 Microsoft Windows 7

More information

기술교육 SSL 설정및변환방법

기술교육 SSL 설정및변환방법 SSL 설정및변환방법 2014. 03. 10 목차 WebtoB에서의 SSL 설정방법... 3 1. WebtoB 에서의 SSL 인증서발급절차... 3 1.1 openssl사용... 3 1.1.1 newreq.pem 파일설명... 3 1.1.2 인증기관에 CSR파일전송... 4 1.1.3 p7b파일변환... 4 1.2 WebtoB의환경설정... 5 1.2.1 http.m

More information

PowerChute Personal Edition v3.1.0 에이전트 사용 설명서

PowerChute Personal Edition v3.1.0 에이전트 사용 설명서 PowerChute Personal Edition v3.1.0 990-3772D-019 4/2019 Schneider Electric IT Corporation Schneider Electric IT Corporation.. Schneider Electric IT Corporation,,,.,. Schneider Electric IT Corporation..

More information

아이콘의 정의 본 사용자 설명서에서는 다음 아이콘을 사용합니다. 참고 참고는 발생할 수 있는 상황에 대처하는 방법을 알려 주거나 다른 기능과 함께 작동하는 방법에 대한 요령을 제공합니다. 상표 Brother 로고는 Brother Industries, Ltd.의 등록 상

아이콘의 정의 본 사용자 설명서에서는 다음 아이콘을 사용합니다. 참고 참고는 발생할 수 있는 상황에 대처하는 방법을 알려 주거나 다른 기능과 함께 작동하는 방법에 대한 요령을 제공합니다. 상표 Brother 로고는 Brother Industries, Ltd.의 등록 상 Android 용 Brother Image Viewer 설명서 버전 0 KOR 아이콘의 정의 본 사용자 설명서에서는 다음 아이콘을 사용합니다. 참고 참고는 발생할 수 있는 상황에 대처하는 방법을 알려 주거나 다른 기능과 함께 작동하는 방법에 대한 요령을 제공합니다. 상표 Brother 로고는 Brother Industries, Ltd.의 등록 상표입니다. Android는

More information

슬라이드 1

슬라이드 1 PKI Kerberos SAML & Shibboleth OpenID Cardspace & ID 2 < > (= ) password, OTP, bio, smartcard, pki CardSpace, ID What you have.., 2 factor, strong authentication 4 (SSO) Kerberos, OpenID 5 Shared authentication

More information

1) 인증서만들기 ssl]# cat >www.ucert.co.kr.pem // 설명 : 발급받은인증서 / 개인키파일을한파일로저장합니다. ( 저장방법 : cat [ 개인키

1) 인증서만들기 ssl]# cat   >www.ucert.co.kr.pem // 설명 : 발급받은인증서 / 개인키파일을한파일로저장합니다. ( 저장방법 : cat [ 개인키 Lighttpd ( 멀티도메인 ) SSL 인증서신규설치가이드. [ 고객센터 ] 한국기업보안. 유서트기술팀 1) 인증서만들기 [root@localhost ssl]# cat www.ucert.co.kr.key www.ucert.co.kr.crt >www.ucert.co.kr.pem // 설명 : 발급받은인증서 / 개인키파일을한파일로저장합니다. ( 저장방법 : cat

More information

소개 TeraStation 을 구입해 주셔서 감사합니다! 이 사용 설명서는 TeraStation 구성 정보를 제공합니다. 제품은 계속 업데이트되므로, 이 설명서의 이미지 및 텍스트는 사용자가 보유 중인 TeraStation 에 표시 된 이미지 및 텍스트와 약간 다를 수

소개 TeraStation 을 구입해 주셔서 감사합니다! 이 사용 설명서는 TeraStation 구성 정보를 제공합니다. 제품은 계속 업데이트되므로, 이 설명서의 이미지 및 텍스트는 사용자가 보유 중인 TeraStation 에 표시 된 이미지 및 텍스트와 약간 다를 수 사용 설명서 TeraStation Pro II TS-HTGL/R5 패키지 내용물: 본체 (TeraStation) 이더넷 케이블 전원 케이블 TeraNavigator 설치 CD 사용 설명서 (이 설명서) 제품 보증서 www.buffalotech.com 소개 TeraStation 을 구입해 주셔서 감사합니다! 이 사용 설명서는 TeraStation 구성 정보를

More information

Page 2 of 6 Here are the rules for conjugating Whether (or not) and If when using a Descriptive Verb. The only difference here from Action Verbs is wh

Page 2 of 6 Here are the rules for conjugating Whether (or not) and If when using a Descriptive Verb. The only difference here from Action Verbs is wh Page 1 of 6 Learn Korean Ep. 13: Whether (or not) and If Let s go over how to say Whether and If. An example in English would be I don t know whether he ll be there, or I don t know if he ll be there.

More information

Copyright 2012, Oracle and/or its affiliates. All rights reserved.,.,,,,,,,,,,,,.,...,. U.S. GOVERNMENT END USERS. Oracle programs, including any oper

Copyright 2012, Oracle and/or its affiliates. All rights reserved.,.,,,,,,,,,,,,.,...,. U.S. GOVERNMENT END USERS. Oracle programs, including any oper Windows Netra Blade X3-2B( Sun Netra X6270 M3 Blade) : E37790 01 2012 9 Copyright 2012, Oracle and/or its affiliates. All rights reserved.,.,,,,,,,,,,,,.,...,. U.S. GOVERNMENT END USERS. Oracle programs,

More information

Interstage4 설치가이드

Interstage4 설치가이드 Interstage Application Server V501 Operation Guide Internet 1 1 1 FJApache FJApache (WWW (WWW server) server) - - file file - - 2 2 InfoProviderPro InfoProviderPro (WWW (WWW server) server) - - file file

More information

1) 인증서만들기 ssl]# cat >www.ucert.co.kr.pem // 설명 : 발급받은인증서 / 개인키파일을한파일로저장합니다. ( 저장방법 : cat [ 개인키

1) 인증서만들기 ssl]# cat   >www.ucert.co.kr.pem // 설명 : 발급받은인증서 / 개인키파일을한파일로저장합니다. ( 저장방법 : cat [ 개인키 Lighttpd ( 단일도메인 ) SSL 인증서신규설치가이드. [ 고객센터 ] 한국기업보안. 유서트기술팀 1) 인증서만들기 [root@localhost ssl]# cat www.ucert.co.kr.key www.ucert.co.kr.crt >www.ucert.co.kr.pem // 설명 : 발급받은인증서 / 개인키파일을한파일로저장합니다. ( 저장방법 : cat

More information

Multi Channel Analysis. Multi Channel Analytics :!! - (Ad network ) Report! -! -!. Valuepotion Multi Channel Analytics! (1) Install! (2) 3 (4 ~ 6 Page

Multi Channel Analysis. Multi Channel Analytics :!! - (Ad network ) Report! -! -!. Valuepotion Multi Channel Analytics! (1) Install! (2) 3 (4 ~ 6 Page Multi Channel Analysis. Multi Channel Analytics :!! - (Ad network ) Report! -! -!. Valuepotion Multi Channel Analytics! (1) Install! (2) 3 (4 ~ 6 Page ) Install!. (Ad@m, Inmobi, Google..)!. OS(Android

More information

1. Windows 설치 (Client 설치 ) 원하는위치에다운받은발송클라이언트압축파일을해제합니다. Step 2. /conf/config.xml 파일수정 conf 폴더에서 config.xml 파일을텍스트에디터를이용하여 Open 합니다. config.xml 파일에서, 아

1. Windows 설치 (Client 설치 ) 원하는위치에다운받은발송클라이언트압축파일을해제합니다. Step 2. /conf/config.xml 파일수정 conf 폴더에서 config.xml 파일을텍스트에디터를이용하여 Open 합니다. config.xml 파일에서, 아 LG U+ SMS/MMS 통합클라이언트 LG U+ SMS/MMS Client Simple Install Manual LG U+ SMS/MMS 통합클라이언트 - 1 - 간단설치매뉴얼 1. Windows 설치 (Client 설치 ) 원하는위치에다운받은발송클라이언트압축파일을해제합니다. Step 2. /conf/config.xml 파일수정 conf 폴더에서 config.xml

More information

ISP and CodeVisionAVR C Compiler.hwp

ISP and CodeVisionAVR C Compiler.hwp USBISP V3.0 & P-AVRISP V1.0 with CodeVisionAVR C Compiler http://www.avrmall.com/ November 12, 2007 Copyright (c) 2003-2008 All Rights Reserved. USBISP V3.0 & P-AVRISP V1.0 with CodeVisionAVR C Compiler

More information

Webtob( 멀티도메인 ) SSL 인증서갱신설치가이드 본문서는주식회사한국기업보안에서 SSL 보안서버인증서설치를위해작성된문서로 주식회사한국기업보안의동의없이무단으로사용하실수없습니다. [ 고객센터 ] 한국기업보안. 유서트기술팀 Copyright 201

Webtob( 멀티도메인 ) SSL 인증서갱신설치가이드 본문서는주식회사한국기업보안에서 SSL 보안서버인증서설치를위해작성된문서로 주식회사한국기업보안의동의없이무단으로사용하실수없습니다. [ 고객센터 ] 한국기업보안. 유서트기술팀 Copyright 201 Webtob( 멀티도메인 ) SSL 인증서갱신설치가이드. [ 고객센터 ] 한국기업보안. 유서트기술팀 02-512-9375 멀티및와일드인증서의경우포트번호를동일하게설정이가능하다. (https 통신으로 443 으로통일가능 ) 1. 발급받으신인증서를해당 SSL 폴더에업로드또는저장합니다. [root@localhost New]$ cp star.ucert.co.kr* /webtob/ssl

More information

Intro to Servlet, EJB, JSP, WS

Intro to Servlet, EJB, JSP, WS ! Introduction to J2EE (2) - EJB, Web Services J2EE iseminar.. 1544-3355 ( ) iseminar Chat. 1 Who Are We? Business Solutions Consultant Oracle Application Server 10g Business Solutions Consultant Oracle10g

More information

¹Ìµå¹Ì3Â÷Àμâ

¹Ìµå¹Ì3Â÷Àμâ MIDME LOGISTICS Trusted Solutions for 02 CEO MESSAGE MIDME LOGISTICS CO., LTD. 01 Ceo Message We, MIDME LOGISTICS CO., LTD. has established to create aduance logistics service. Try to give confidence to

More information

FileMaker 15 ODBC 및 JDBC 설명서

FileMaker 15 ODBC 및 JDBC 설명서 FileMaker 15 ODBC JDBC 2004-2016 FileMaker, Inc.. FileMaker, Inc. 5201 Patrick Henry Drive Santa Clara, California 95054 FileMaker FileMaker Go FileMaker, Inc.. FileMaker WebDirect FileMaker, Inc... FileMaker.

More information

제20회_해킹방지워크샵_(이재석)

제20회_해킹방지워크샵_(이재석) IoT DDoS DNS (jaeseog@sherpain.net) (www.sherpain.net) DDoS DNS DDoS / DDoS(Distributed DoS)? B Asia Broadband B Bots connect to a C&C to create an overlay network (botnet) C&C Provider JP Corp. Bye Bye!

More information

초보자를 위한 ADO 21일 완성

초보자를 위한 ADO 21일 완성 ADO 21, 21 Sams Teach Yourself ADO 2.5 in 21 Days., 21., 2 1 ADO., ADO.? ADO 21 (VB, VBA, VB ), ADO. 3 (Week). 1, 2, COM+ 3.. HTML,. 3 (week), ADO. 24 1 - ADO OLE DB SQL, UDA(Universal Data Access) ADO.,,

More information

Microsoft Word - Automap3

Microsoft Word - Automap3 사 용 설 명 서 본 설명서는 뮤직메트로에서 제공합니다. 순 서 소개 -------------------------------------------------------------------------------------------------------------------------------------------- 3 제품 등록 --------------------------------------------------------------------------------------------------------------------------------------

More information

ApacheWebServer.hwp

ApacheWebServer.hwp Apache Web Server SSL 설정방법 - Ver 1.0-2008. 5 개정이력 버전개정일개정내용 Ver 1.0 2008 년 5 월 Apache Web Server SSL 설명서최초작성 본문서는정보통신부 한국정보보호진흥원의 보안서버구축가이드 를참고하여작성되었습니다. 본문서내용의무단도용및사용을금합니다. < 목차 > 1. Apache 서버에 OpenSSL

More information

TCP.IP.ppt

TCP.IP.ppt TCP/IP TCP/IP TCP/IP TCP/IP TCP/IP Internet Protocol _ IP Address Internet Protocol _ Subnet Mask Internet Protocol _ ARP(Address Resolution Protocol) Internet Protocol _ RARP(Reverse Address Resolution

More information

untitled

untitled CAN BUS RS232 Line Ethernet CAN H/W FIFO RS232 FIFO IP ARP CAN S/W FIFO TERMINAL Emulator COMMAND Interpreter ICMP TCP UDP PROTOCOL Converter TELNET DHCP C2E SW1 CAN RS232 RJ45 Power

More information

Facebook API

Facebook API Facebook API 2조 20071069 임덕규 20070452 류호건 20071299 최석주 20100167 김민영 목차 Facebook API 설명 Android App 생성 Facebook developers App 등록 Android App Facebook SDK 추가 예제 Error 사항정리 Facebook API Social Plugin Facebook

More information

Subnet Address Internet Network G Network Network class B networ

Subnet Address Internet Network G Network Network class B networ Structure of TCP/IP Internet Internet gateway (router) Internet Address Class A Class B Class C 0 8 31 0 netid hostid 0 16 31 1 0 netid hostid 0 24 31 1 1 0 netid hostid Network Address : (A) 1 ~ 127,

More information

Voice Portal using Oracle 9i AS Wireless

Voice Portal using Oracle 9i AS Wireless Voice Portal Platform using Oracle9iAS Wireless 20020829 Oracle Technology Day 1 Contents Introduction Voice Portal Voice Web Voice XML Voice Portal Platform using Oracle9iAS Wireless Voice Portal Video

More information

thesis-shk

thesis-shk DPNM Lab, GSIT, POSTECH Email: shk@postech.ac.kr 1 2 (1) Internet World-Wide Web Web traffic Peak periods off-peak periods peak periods off-peak periods 3 (2) off-peak peak Web caching network traffic

More information

개요오라클과티베로에서 JDBC 를통해접속한세션을구분할수있도록 JDBC 접속시 ConnectionProperties 를통해구분자를넣어줄수있다. 하나의 Node 에다수의 WAS 가있을경우 DB 에서 Session Kill 등의동작수행시원하는 Session 을선택할수있다.

개요오라클과티베로에서 JDBC 를통해접속한세션을구분할수있도록 JDBC 접속시 ConnectionProperties 를통해구분자를넣어줄수있다. 하나의 Node 에다수의 WAS 가있을경우 DB 에서 Session Kill 등의동작수행시원하는 Session 을선택할수있다. 설치및환경설정 JDBC 접속세션구분 / 확인 2013. 11. 01 개요오라클과티베로에서 JDBC 를통해접속한세션을구분할수있도록 JDBC 접속시 ConnectionProperties 를통해구분자를넣어줄수있다. 하나의 Node 에다수의 WAS 가있을경우 DB 에서 Session Kill 등의동작수행시원하는 Session 을선택할수있다. 사용하기 JEUS 에서설정방법

More information

PCServerMgmt7

PCServerMgmt7 Web Windows NT/2000 Server DP&NM Lab 1 Contents 2 Windows NT Service Provider Management Application Web UI 3 . PC,, Client/Server Network 4 (1),,, PC Mainframe PC Backbone Server TCP/IP DCS PLC Network

More information

1217 WebTrafMon II

1217 WebTrafMon II (1/28) (2/28) (10 Mbps ) Video, Audio. (3/28) 10 ~ 15 ( : telnet, ftp ),, (4/28) UDP/TCP (5/28) centralized environment packet header information analysis network traffic data, capture presentation network

More information

1

1 1 1....6 1.1...6 2. Java Architecture...7 2.1 2SDK(Software Development Kit)...8 2.2 JRE(Java Runtime Environment)...9 2.3 (Java Virtual Machine, JVM)...10 2.4 JVM...11 2.5 (runtime)jvm...12 2.5.1 2.5.2

More information

vm-웨어-01장

vm-웨어-01장 Chapter 16 21 (Agenda). (Green),., 2010. IT IT. IT 2007 3.1% 2030 11.1%, IT 2007 1.1.% 2030 4.7%, 2020 4 IT. 1 IT, IT. (Virtualization),. 2009 /IT 2010 10 2. 6 2008. 1970 MIT IBM (Mainframe), x86 1. (http

More information

Backup Exec

Backup Exec (sjin.kim@veritas.com) www.veritas veritas.co..co.kr ? 24 X 7 X 365 Global Data Access.. 100% Storage Used Terabytes 9 8 7 6 5 4 3 2 1 0 2000 2001 2002 2003 IDC (TB) 93%. 199693,000 TB 2000831,000 TB.

More information

,,,,,, (41) ( e f f e c t ), ( c u r r e n t ) ( p o t e n t i a l difference),, ( r e s i s t a n c e ) 2,,,,,,,, (41), (42) (42) ( 41) (Ohm s law),

,,,,,, (41) ( e f f e c t ), ( c u r r e n t ) ( p o t e n t i a l difference),, ( r e s i s t a n c e ) 2,,,,,,,, (41), (42) (42) ( 41) (Ohm s law), 1, 2, 3, 4, 5, 6 7 8 PSpice EWB,, ,,,,,, (41) ( e f f e c t ), ( c u r r e n t ) ( p o t e n t i a l difference),, ( r e s i s t a n c e ) 2,,,,,,,, (41), (42) (42) ( 41) (Ohm s law), ( ),,,, (43) 94 (44)

More information

TTA Journal No.157_서체변경.indd

TTA Journal No.157_서체변경.indd 표준 시험인증 기술 동향 FIDO(Fast IDentity Online) 생체 인증 기술 표준화 동향 이동기 TTA 모바일응용서비스 프로젝트그룹(PG910) 의장 SK텔레콤 NIC 담당 매니저 76 l 2015 01/02 PASSWORDLESS EXPERIENCE (UAF standards) ONLINE AUTH REQUEST LOCAL DEVICE AUTH

More information

PBNM CIM(Common Information Model) DEN, COPS LDAP 21 CIM (Common Information Model) CIM, specification schema [7]

PBNM CIM(Common Information Model) DEN, COPS LDAP 21 CIM (Common Information Model) CIM, specification schema [7] (Policy-Based Network Management Technology) ((ksok, dsyun)@ktcokr) PBNM CIM(Common Information Model) DEN, COPS LDAP 21 CIM (Common Information Model) CIM, specification schema [7] 1 CIM core model hierarchy

More information

목차 데모 홖경 및 개요... 3 테스트 서버 설정... 4 DC (Domain Controller) 서버 설정... 4 RDSH (Remote Desktop Session Host) 서버 설정... 9 W7CLIENT (Windows 7 Client) 클라이얶트 설정

목차 데모 홖경 및 개요... 3 테스트 서버 설정... 4 DC (Domain Controller) 서버 설정... 4 RDSH (Remote Desktop Session Host) 서버 설정... 9 W7CLIENT (Windows 7 Client) 클라이얶트 설정 W2K8 R2 RemoteApp 및 Web Access 설치 및 구성 Step-By-Step 가이드 Microsoft Korea 이 동 철 부장 2009. 10 페이지 1 / 60 목차 데모 홖경 및 개요... 3 테스트 서버 설정... 4 DC (Domain Controller) 서버 설정... 4 RDSH (Remote Desktop Session Host)

More information

. PC PC 3 [ ] [ ], [ ] [ ] [ ] 3 [ ] [ ], 4 [ ] [ ], 4 [Internet Protocol Version 4 (TCP/IPv4)] 5 [ ] 6 [ IP (O)], [ DNS (B)] 7 [ ] 한국어 -

. PC PC 3 [ ] [ ], [ ] [ ] [ ] 3 [ ] [ ], 4 [ ] [ ], 4 [Internet Protocol Version 4 (TCP/IPv4)] 5 [ ] 6 [ IP (O)], [ DNS (B)] 7 [ ] 한국어 - Quick Network Setup Guide xdsl/cable Modem PC DVR ~3.., PC, DVR. Cable IP Cable/ADSL/ VDSL or 3 4 VIDEO OUT (SPOT) AUDIO IN VGA ALARM OUT COM ALARM IN RS-485 3 4 G G + 3 CONSOLE NETWORK DC V VIDEO IN VIDEO

More information

01Àå

01Àå CHAPTER 01 1 Fedora Fedora Linux Toolbox 2003 Fedora Core( ) http://fedoraproject.org www.redhat.com 2 CHAPTER Fedora RHEL GNU public license www.centos.org www.yellowdoglinux.com www. lineox.net www.

More information

Chap7.PDF

Chap7.PDF Chapter 7 The SUN Intranet Data Warehouse: Architecture and Tools All rights reserved 1 Intranet Data Warehouse : Distributed Networking Computing Peer-to-peer Peer-to-peer:,. C/S Microsoft ActiveX DCOM(Distributed

More information

Secure Programming Lecture1 : Introduction

Secure Programming Lecture1 : Introduction Malware and Vulnerability Analysis Lecture3-2 Malware Analysis #3-2 Agenda 안드로이드악성코드분석 악성코드분석 안드로이드악성코드정적분석 APK 추출 #1 adb 명령 안드로이드에설치된패키지리스트추출 adb shell pm list packages v0nui-macbook-pro-2:lecture3 v0n$

More information

ARMBOOT 1

ARMBOOT 1 100% 2003222 : : : () PGPnet 1 (Sniffer) 1, 2,,, (Sniffer), (Sniffer),, (Expert) 3, (Dashboard), (Host Table), (Matrix), (ART, Application Response Time), (History), (Protocol Distribution), 1 (Select

More information

ApeosPort-V 7080/6080, DocuCentre-V 7080/6080 User Guide (For AirPrint)

ApeosPort-V 7080/6080, DocuCentre-V 7080/6080 User Guide (For AirPrint) ApeosPort-V 7080 DocuCentre-V 7080 ApeosPort-V 6080 DocuCentre-V 6080 사용설명서 (AirPrint 용 ) 당사 제품을 선택해 주셔서 감사합니다. 이 설명서에서는 AirPrint 조작 방법을 설명하고 조작 중 지켜야 할 주의 사항에 대한 정보를 제공합니다. 사용하기 전에 이 설명서를 반드시 읽으십시오. 이

More information