|
|
- 채원 묵
- 6 years ago
- Views:
Transcription
1
2
3
4
5
6
7
8
9 3)
10 4
11
12
13
14 Genetic Analysis for Bacterial Leaf Pustule Resistance for Improvement of Soybean Varieties Bacterial leaf pustule (BLP) caused by Xanthomonas axonopodis pv. glycines is one of the most prevalent bacterial diseases in plants. Early symptoms are characterized by small,yellow-to-brown lesions with a raised pustule in the center. The lesions progressively merge to form large necrotic areas, which cause premature defoliation and subsequently a loss of grain yield. The first goal of this research was performed to identify quantitative trait loci (QTL) for resistance to BLP as well as to understand the resistance of soybean genotypes to different BLP isolates. Also, candidate gene analysis and differential display between resistant and susceptible soybean genotypes was performed to develop BLP-specific DNA markers. 1. Genetic Analysis for Bacterial Leaf Pustule Resistance for Improvement of Soybean Varieties Quantitative trait loci (QTLs) for resistance to BLP in soybean (Glycine max [L.] Merr.) were identified using simple sequence repeat (SSR) markers, and the consistency of QTL detection across bacterial isolates as well as across greenhouse and field experiments were examined. Recombinant inbred lines (RILs) derived from a cross of BLP-susceptible 'Suwon157' and BLP-resistant 'Danbaekkong' were utilized to identify QTL conditioning the resistance to BLP with 76 SSR markers. For phenotypic analysis, six isolates of X. axonopodis were collected from different geographic origins (ocsf, ocsg and sd12178 from Korea, 8ra from USA, LMG7403 from Zambia, and LMG7404 from Zimbabwe). A combination of single-factor analysis of variance and multiple regression analysis revealed that three QTLs conditioned resistance to BLP in the field. Under greenhouse condition, one to four QTLs were revealed to be associated with resistance to each isolate. Satt372 on linkage group (LG) D2 was detected across six isolates under both greenhouse andfield conditions, an indication that resistance to BLP was mainly controlled by a single major gene tightly linked to Satt372. Several minor QTLson LG A1, C1, F, L, and O were also
15 found depending on the isolates. seventy-five different soybean cultivars were tested for the response to several different X.campestris pv. glycines races collected worldwide. Among tested cultivars, one cultivar, G. max cv. PI96188 showed very different response to all X. campestris pv. glycines races. It showed HR-like necrosis without halos but still carried pustules in the back of the necrosis symptom. Rxp gene conferring resistance to bacterial pustule was reported to be on linkage group (LG) D2. The gene controlling the novel response in PI96188 was mapped to whether the gene was the same as Rxp. An RIL population from a cross of PI96188 and Jinju 1 was constructed. Five markers on LG D2 were not associated with novel response in PI96188, indicating that the gene controlling this specific response was different from Rxp. Further mapping study revealed that Sat_108 on LG O was identified as being associated with novel response in PI
16 3. Search for Molecular Markers for Bacterial Leaf Pustule Resistance through the Analysis of Disease resistance and Phathogenesis-Related Genes
17
18 Genetic Analysis for Bacterial Leaf Pustule Resistance for Improvement of Soybean Varieties
19 Search for Molecular Markers for Bacterial Leaf Pustule Resistance through the Analysis of Disease resistance and Phathogenesis-Related Genes
20
21
22 1. 기술적측면
23
24 1. 국내연구현황 8ra F G ± ± ± ± ± ± - ++ ± ± ± ± ± ± ± ± ± ± ± ± - ± ± - ± ± (+++; very susceptible, ++; susceptible, +; mid, ±; resistant, -; very resistant)
25
26
27
28 제 1 세부과제 내병성계통유전형질분석 RIL 집단양성 ( 태국 ) Marker-Assisted Selection 내병성계통육성 협제 2 동세과부과제제 병균침입시발현되는특이적저항성콩유전자 식물병저항성유전자유사체 PCR 마커개발 식물유전자개발 콩의병저항성병저항성유전자와비병원성유전자의상호이해에의한내병성계통선발체계선발체계확립 불마름병균유전자연구 병원균 계열 지표작성 제 1 세부과제 불마름병저항성저항성콩계통개발
29 제 1 세부과제 ( 서울대이석하 ) 제 2 세부과제 ( 서울대백남천 ) 협동과제 ( 전북대윤성중 ) 제 1 세부과제 ( 농과원허성기 ) 콩불마름병저항성유전분석및내병성콩계통육성 콩불마름병특이적저항성콩유전자분리및마커개발 콩불마름병저항성관련후보식물유전자분석에의한마커개발 콩불마름병 생리적 균계분화 및 발병기작 연구 제 1 차년도 저항성과감수성품종간 F1 양성및 F2 종자를태국으로송부, 세대진전 콩유전자원 60 여점불마름병균계별저항성평가및모부본간 polymorphism 조사, 150 여 SSR 마커선발 불마름병특이적 저항성콩유전자의분리 ( DDRT-PCR, SSH) 저항성콩유전자발현특성조사 Full-length cdna 분리 타식물에서이미분리및보고된 병저항성유전자들의염기서열비교분석 염기서열의비교분석에의한 Primer 제작및 PCR cloning 으로유전자유사체분리 우리나라에서콩불마름병수집, 분리, 동정 및분화형조사 균계별품종간의 친화정도를조사 제 2 차년도 콩유전자원 60 여점불마름병균계별저항성평가및모부본간 polymorphism 조사, 150 여 SSR 마커선발 후기세대 집단양성 RIL(F 6) 분리된 유전자 염기서열 확인및 타식물의 병저항성 유전자들과 비교분석 분리된콩유전자의저항성기능검정 ( 세균감수성인담배와아기장대모델식물로형질전환 ) 타식물병저항성 유전자유사체 콩 cdna 의 발현특성 조사 cdna library 에서 full-length cdna 분리하여 염기서열확인 분화형을구분하여균계분화지표를작성 제 3 차년도 콩유전자원 60 여점 저항성 평가, 150 여 SSR 마커선발 SSR 마커에 의한 저항성과 감수성 품종간의 450 여 마커 polymorphism 조사및연관조사 내병성콩계통개발 불마름병 특이적 저항성 콩유전자들과 저항성 분리집단을 이용한 RFLP 연관도 조사 및 98% 이상정확도의 제한효소 확립 콩불마름병 저항성 육종을 위한 유전자 마커개발 분리집단을 이용하여 저항성 유전자유사체 clone 들의 RFLP map 과 연관도조사및 내병성육종의 마커개발 콩후기세대에서콩불마름병저항성계통육성 ( 5 여계통확립 ) 콩불마름병특이적저항성콩유전자다수확보및유전자마커개발콩의타식물병저항성유전자유사체를이용한마커 2 종이상개발우리나라콩불마름병균계분화지표작성
30
31
32
33
34 LG χ 1 satt155 A satt236 A satt276 A satt545 A satt177 A satt187 A satt409 A satt197 B1/S satt415 B1/S satt426 B1/S satt509 B1/S satt168 B2/P satt556 B2/P satt577 B2/P sat-085 C
35 LG 16 satt180 C satt294 C satt396 C satt134 C satt202 C satt277 C satt286 C satt291 C satt322 C satt147 D1a/Q satt179 D1a/Q satt408 D1a/Q satt532 D1a/Q satt189 D1b/W satt290 D1b/W satt186 D2/R satt226 D2/R satt372 D2/R satt458 D2/R satt389 D2/R satt397 D2/R satt154 D2/R sat-112 E satt185 E satt411 E sat-074 F satt114 F satt160 F satt269 F satt224 G satt288 G satt324 G sat_122 H satt192 H satt279 H χ
36 LG 51 satt317 H satt353 H satt434 H satt442 H satt541 H satt239 I satt292 I satt571 I satt183 J satt215 J satt244 J satt285 J satt414 J satt431 J satt167 K satt196 K satt441 K satt143 L satt156 L satt373 L satt462 L satt336 M satt590 M GMABAB N satt584 N satt188 O satt243 O satt259 O satt445 O χ
37 표 1-2. 수원157 호 단백콩의유전자지도특성 그림 1-1. 유전자지도( 수원157호x 단백콩) LGA1 LGA2 LGB1 Satt276 Satt Satt177 Satt Satt197 Satt Satt Satt Satt409 LGC1 Satt236 LGB2 Satt396 Satt Satt Satt294 Sat_
38 LGD1a+Q Satt147 Satt Satt179 Satt532 LGD1a+Q Satt147 Satt Satt179 Satt532 LGD1b+W 0.9 Satt189 Satt290 LGD1b+W 0.9 Satt189 Satt290 LGC Satt291 Satt322 Satt Satt Satt277 Satt202 LGC Satt291 Satt322 Satt Satt Satt277 Satt202 LGE Sat_112 Satt LGE Sat_112 Satt LGF Satt269 Satt160 Satt114 Sat_074 LGF Satt269 Satt160 Satt114 Sat_074 LGG Satt288 Satt224 Satt324 LGG Satt288 Satt224 Satt324 LGD2 8.7 Satt458 Satt154 Satt Satt186 Satt372 Satt397 Satt LGD2 8.7 Satt458 Satt154 Satt Satt186 Satt372 Satt397 Satt
39 LGJ Satt285 Satt414 Satt183 Satt215 Satt244 Satt LGJ Satt285 Satt414 Satt183 Satt215 Satt244 Satt LGI 9.8 Satt571 Satt239 Satt292 LGI 9.8 Satt571 Satt239 Satt292 LGH Satt353 Satt Satt442 Satt541 Sat_122 Satt279 Satt317 Satt LGH Satt353 Satt Satt442 Satt541 Sat_122 Satt279 Satt317 Satt LGO Satt445 Satt259 Satt188 LGO Satt445 Satt259 Satt188 LGL Satt143 Satt462 Satt Satt156 LGL Satt143 Satt462 Satt Satt156 LGK Satt441 Satt LGK Satt441 Satt
40 표 1. 수원157 단백콩 F2개체에대한 Satt372 마커의분리비와병원균의표현형. Satt372 N Mean S/S S/D D/D 개체수 수원 157 호 단백콩 병저항성 그림 1. 수원157 단백콩 F2개체에대한 ocsf 병원균의표현형분리.
41 표2. Means and ranges of parents and RIL progenies for the resistance to bacterial leaf pustule in soybean Isolate a 8ra OCS-F OCS-G SDL2178 LMG7403 LMG7404 Field b Female parent Male Parent Progeny 1.0~ ~ ~ ~ ~ ~ ~ 4.8 LSD Progeny Mean H2(%) a Disease severity was scored on the basis of the number of small, yellow-to-brown lesions with a raised pustule per leaflet on a scale of 0 to 5 (0 = no legion, 1 = 1 to 25 lesions, 2 = 26 to 50 lesions, 3 = 51 to 75 lesions, 4 = 76 to 100 lesions, and 5 = more than 100 lesions). b Disease severity was scored on a scale of 0 to 5(0=no visible symptoms to 5=heavily infected)
42 표 3. Markers linked to QTLs associated with the resistance to BLP disease under greenhouse experiment using an RIL population derived from a cross of the susceptible Suwon157 and the resistant Danbaekkong in soybean SF-ANOVA a SLG-Regr a MLG-Regr a Isaolate Locus LG Allelic means b P R2 P R2 P R2 S/S D/D % ---score-- % % 8ra Satt509 B1/S NA c Satt372 D2/R < < Satt458 D2/R < Satt156 L NA Satt243 O NA Total 31 OCS-F Satt134 C NA Satt372 D2/R < < < Satt458 D2/R < Satt353 H NA Satt156 L NA Total 43 OCS-G Satt177 A NA Satt372 D2/R < < < Satt458 D2/R < Satt167 K Satt441 K Satt143 L NA Total 45 SDL2178 Satt294 C Satt396 C Satt291 C NA Satt372 D2/R < < < Satt458 D2/R Satt336 M NA Total 32 LMG7403 Satt155 A NA Satt134 C NA Satt372 D2/R < < Satt458 D2/R < Satt269 F NA Satt156 L NA Satt259 O NA Total 50 LMG7404 Satt372 D2/R < < < Satt458 D2/R < Total 39
43 a SF-ANOVA: single factor analysis of variance SLG-Regr: Multiple regression with markers on each linkage group MLG-Regr: multiple regression with all significant markers from the SLG-Regr model b S/S: homozygous Suwon 157, D/D : homozygous Danbaekkong c Not applicable. Not linked to other markers Satt Satt Satt Satt236 Satt Satt Sat_085 Satt Satt186 Satt Satt458 LG A1 LG C1 LGD2 Satt Satt160 Satt Field Satt462 Satt Satt156 Satt Satt188 Satt114 Satt373 Satt243 Field 8ra ocsf ocsg LG F LG L LG O 그림2. Soybean linkage groups (LG) showing marker positions and estimated map distance with the independent QTL conditioning the resistance to bacterial leaf pustule disease. Field resistance was evaluated through inoculation (a filled bar) with the mixture of three isolates(ocs-f, SDL2178, LMG7404), while greenhouse resistance was evaluated through individual inoculation with six strains(an open, a dotted, and four hatched bars). Length of horizontal bars indicates R 2 value for the
44 loci.
45
46
47
48
49
50 BamHI 17.5x34 amino acid repeats BamHI
51
52 장엽대원장원소원잎깍지잎깍지잎깍지줄기잎깍지
53
54
55 avrbs3::eztn WT MT WT MT Williams 82 CNS
56
57
58
59
60
61
62 Clone No. 1 1D02 2 1A05 검색결과 Glycine max glycine-rich RNA-binding protein (GRP) mrna Glycine max ribulose-1,5-bisphosphate carboxylase small subunit SS2-2 특이적발현 (by northern blot) N Y 3 1B08 unknown N 4 1D15 Glycine max 28 kda protein mrna Y 5 2A19 Glycine max ribulose-1,5-bisphosphate carboxylase small subunit Y 6 3K02 Glycine max ribulose-1,5-bisphosphate carboxylase small subunit Y 7 3N02 G.hirsutum light regulated unknown reading frame DNA Y 8 3I05 9 3O A15 Glycine max vegetative storage protein mrna (VSP25 gene) N unknown(arabidopsis thaliana photosystem I PSI-N mrna) Y Glycine max vegetative storage protein mrna (VSP25 gene) N 11 3A19 Glycine max vspa gene Y 12 4P04 M.sativa 26S rrna Choristylis rhamnoides 26S ribosomal RNA gene N 13 4J06 unknown (Pseudomonas aeruginosa) N 14 4N14 G.max vegetative storage protien mrna (VSP B) Y 15 4O15 Glycine max repressor protein (Dr1) mrna, complete cds Y 16 4I16 Arabidopsis thaliana unknown protein (F19P19.2) mrna N 17 4C23 Glycine max 28 kda protein mrna Y 18 4G23 unknown N 19 5F2 Arabidopsis thaliana chromosome 2 N 20 5M6 Glycine max 28 kda protein mrna Y
63 21 5N08 Glycine max 28 kda protein mrna Y 22 5M11 G.max vegetative storage protein mrna (VSP25 gene) Y 23 5A15 Glycine max 28 kda protein mrna Y 24 Glycine max gene encoding 5B17 ribulose-1,5-bisphosphate carboxylase small subunit Y 25 5B22 Glycine max 28 kda protein mrna Y 26 6L12 Vigna radiata chlorophyll a/b-binding protein CP24 precursor (CipCp24) mrna Y 27 6H23 Atlantic salmon mrna for myostatin, isoform II Y 28 7C05 Pseudomonas aeruginosa Y 29 7D06 hypothetical protein XP_ [Homo sapiens] N 30 7O07 unknown N 31 7F20 unknown N 32 7L22 Arabidopsis thaliana mrna for putative beta-galactosidas Y 33 7L23 putative senescence-associated protein [Pisum sativum] N 34 7M24 Glycine max Homeodomain Leucine zipper protein Y 35 8A02 Arabidopsis thaliana clone mrna Y 36 8I07 unknown N 37 8I13 (NM_115671) putative protein [Arabidopsis thaliana] N 38 8D14 Arabidopsis thaliana unknown protein mrna Y 39 8J14 cysteine proteinase tpp (EC ) - garden pea N (AC022472) Contains similarity to CaLB protein from 40 8C16 A. thaliana gb X96598 and contains multiple C2 N PF domains 41 8K16 N 42 8L16 imidazoleglycerol-phosphate synthase subunit H - like [Arabidopsis thaliana] N 43 8G21 Arabidopsis thaliana unknown protein (MSJ11.24/AT3g15840) mrna, N 44 8A22 (NM_101113) ATP-dependent Clp protease proteolytic subunit (ClpR2)[Arabidopsis thaliana] N 45 8L24 (AC005169) hypothetical protein [Arabidopsis thaliana] N
64 46 9I01 (AF136636) PR1a precursor [Glycine max] reverse 49 9C E O G19 (NM_115343) vacuolar protein sorting protein 33a-like protein [Arabidopsis thaliana] Arabidopsis thaliana putative RING zinc finger protein (At1g63900) (AP002460) gene_id:f1d9.26~unknown protein [Arabidopsis thaliana] gene_id:f1d9.26~unknown protein [Arabidopsis thaliana] N Y N Y 53 1B05 (X85130) catalase [Campylobacter jejuni] N
65
66
67 β β
68
69
70 Flax L6 ( 241) DDHITAVLEKLSLDSENVTMVGLYGMGGIGKTTTAKAVYNKI-SSCFDCCCFIDNIRETQ Tobacco N ( 192) DTHLEKIESLLEIGINGVRIMGIWGMGGVGKTTIARAIFDTLLGRMDSSYQFDGACFLKD Arab RPS2 ( 159) TTMMEQVLEFLSEEEERGIIGVYGPGGVGKTTLMQSINNELITKGHQYDVLIWVQMSREF Arab RP1 ( 180) DAAKGKLIGWLLSPEPQRIVVSVVGMGGSGKTTLSANIFKSQTVRKHFASYAWVTISKSY Flax L6 ( 300) EKDGVVVLQKKLVSEILRIDSGSVGFNNDSGGRKTIKER-VSRFKILVVLDDVDEKFKFE Tobacco N ( 252) IKENKRGMHSLQNALLSELLREKANYNNEEDGKHQMASR-LRSKKVLIVLDDIDNKDHYL Arab RPS2 ( 219) GECTIQQAVGARLGLSWDEKETGENRALKIYRALRQKRFLLLLDDVWEEIDLEKTGVPRP Arab RP1 ( 240) VIEDVFRTMIKEFYKEAETQIPGELYSLTYRELVEKLVEYLHSKRYFVMLDDVWNTGLWR Flax L6 ( 359) DMLGSPKDFISQSRFIITSRSMRVLGTLNENQCKLYEVGSMSKPRSLELFSKHAFKKNTP Tobacco N ( 311) EYLAGDLDWFGNGSRIIITTRDKHL---IEKNDIIYEVTALPDHESIQLFKQHAFGKEVP Arab RPS2 ( 279) DRENKCKVMF-TTRSIALCNNMGAEYKLRVEFLEKKHAWELFCSKVWRKDLLE Arab RP1 ( 300) EISIALPDGI-SGSRVMVTTRSNNMASFSYGSGSRKHEIELLKEDEAWALFCNKAFSGSL Flax L6 ( 419) PSYYETLANDVVDTTAGLPLTLKVIGSLLFKQEIAVWEDTLEQLRRTLNLDEVYDRLKIS Tobacco N ( 368) NENFEKLSLEVVNYAKGLPLALKVWGSLLHNLRLTEWKSAIEHMK-NNSYSGIIDKLKIS Arab RPS2 ( 331) ----SSSIRRLAEIIVSKCGGLPLALITLGGAMAHRETEEEWIHASEVLTRFPAEMKGMN Arab RP1 ( 359) EECRRRNLEVVARKLVERCQGLPLAIASLGSMMSTKRLESEWKQVYNSLNWELNNNLELK
71
72
73
74 (1) 병저항성유전자유사체의불마름병균에대한반응 Glycinemax cv. Suwon157 RGA3 X. campestrispv. glycines8ra 10 mm MgCl 2 Hours after inoculation Hours after inoculation RGA4 RGA5 RGA6 RGA7 RGA8
75 Glycinemax cv. Danbaek RGA3 X. campestrispv. glycines8ra 10 mm MgCl 2 Hours after inoculation Hours after inoculation RGA4 RGA5 RGA6 RGA7 RGA8
76 RGA3,4 5,6,7,8 DB SW CTL YE PQ H WD UV JA ABA ET SA rrna DB SW RGA3,4 SS 5,6,7,8 JY rrna SS JY
77
78 Glycinemax cv. Suwon157 PR-1a Per PAL CS IFS rrna X. campestrispv. glycines8ra 10 mm MgCl 2 Hours after inoculation Hours after inoculation Glycinemaxcv. Danbaek PR-1a Per PAL CS IFS rrna X. campestrispv. glycines8ra 10 mm MgCl 2 Hours after inoculation Hours after inoculation
79
80 PAL DB SW DB IFS SW CTL YE PQ H WD UV JA ABA ET DB CS SW DB rrna SW IFS CS SS JY SS JY CTL YE PQ H WD UV JA ABA ET SA rrna SS JY
81 Jinju 1 PI96188 CTL YE H JA SA CTL YE H JA SA PAL IFS rrna
82
83 JY IFS mrna rrna CTL YE PQ H WD UV JA ABA ET SA rrna IFS mrna SS
84
85 CTR YE PQ H 2 O 2 WD UV ABA ETH SA DB SW JY SS PI JJ rrna
86 연구 1차년도에는병저항성유전자유사체 5종이상을개발이었으나유전자유사체 6종 을개발하여연구목표를달성하였다. 유전자유사체 6종의불마름병및각종산화스트레스 호르몬에대한반응여부를불마름병저항성과감수성품종에서조사한결과, 유전자유사 체는처리및품종에불구하고발현이유도되지않았다. 불마름병저항성콩으로부터 full-length cdna 2종을분리하여그발
87 현특성을조사하고자하였으며, PAL, IFS, CS, SAM 등의유전자를분리하였다. 이들병 저항성유전자의불마름병및각종산화스트레스호르몬에대한반응여부를조사하였으 나불마름병저항성과감수성품종에서의반응이유사하여이들유전자는불마름병저항 성과직접적인관련이없는것으로나타났다.
88
89
90 Bent AF, Kunkel BN, Dahlbeck D, Brown KL, Schmidt R, Giraudat J, Leung J, Staskawicz BJ RPS2 of Arabidopsis thaliana: a leucine-rich repeat class of plant disease resistance genes. Science 23: Bernard, R. L. and M. G. Weiss Qualitative genetics. P In B. E. Caldwell (ed.), Soybean: Improvement, production, and uses. monogr. 16. ASA, Madison, WI. Agron. Bellato CM.1997.REGULATION OF THE EXPRESSION OF THE NOD BOX-INDEPENDENT NODULATION GENE, NOLX, IN SINORHIZOBIUM FREDII, A NITROGEN-FIXING SYMBIONT OF LEGUME PLANTS.FEMS Microbiology Letters,1;157 (1): Buschges R, K. Hollricher, R. Panstruga, G. Simons, M. Wolter, A. Frijters, R. van Daelen, T. van der Lee, P. Diergaarde, J. Groenendijk, S. Topsch, P. Vos, F. Salamini, P. Schulze-Lefert The barley Mlo gene: a novel control element of plant pathogen resistance. Cell 7: Cregan, P Personal comm. 차광홍이용환고숙주박종대박인진 농작물병해정밀조사 : 전남지역주요재배작 물의병해종류조사. 시험연구보고서, 전라남도농업기술원. α β Grant MR, Godiard L, Straube E, Ashfield T, Lewald J, Sattler A, Innes RW, Dangl JL Structure of the Arabidopsis RPM1 gene enabling dual specificity disease resistance. Science 269: Groth, D. E. and E. J. Braun Growth kinetics and histopathology of
91 Xanthomonas campestris pv. glycines in leaves of resistant and susceptible soybeans. Phytopathology 76(10): Hartwig, E. E. and H. W. Johnson Effect of the bacterial pustule disease on yield and chemical composition of soybeans. Agron. J. 45: Hartwig, E. E. and S. G. Lehman Inheritance of resistance to the bacterial pustule disease in soybeans. Agron. J. 43: 황인규임승만 콩불마름병균의병원성변이.Korean journal of plant pathology Vol.14(1) pp Hwang, I and S. M. Lim Pathogenic variability in isolates of Xanthomonas campestris pv. glycines. Korean J. Plant Pathol. 14(1): Kanazin, V., L.F. Marek, R.C. Shoemaker Resistance gene analogs are conserved and clustered in soybean. Proc. Natl. Acad. Sci. USA. 93: Laviolette, F. A., K. L. Athow, A. H. Probst, and J. P. Wilcox Effect of bacterial pustule on yield of soybeans. Crop Sci. 10:
92 Ludwig, A., and R. Tenhaken Defense gene expression in soybean is linked to the status of the cell death program. Plant Mol. Biol. 44: 이승돈 한국의주요식물세균병발생및특성. Ph.D. Thesis. Seoul Nat'l Univ. 우정허성기조용섭 콩불마름병균의생장조건이박테리오신인 glycinecin의생성에 미치는영향. 한국식물병리학회지 Vol.14(5) pp Manjaya JG.1999.New genes for resistance to Xanthomonas campestris pv. glycines in soybean [Glycine max (L.) Merr.] and their inheritance. Euphytica ;106(3) Narvel, J.M., L.R. Jakkula, D.V. Phillips, T. Wang, S.H. Lee, and H.R. Boerma Molecular mapping and pedigree analysis of Rxp conditioning reaction to bacterial pustule in soybean. Submitted to J. Heredity Oh C.1999.An hrcu-homologous gene mutant of Xanthomonas campestris pv. glycines 8ra that lost pathogenicity on the host plant but was able to elicit the hypersensitive response on nonhosts.molecular Plant-Microbe Interactions ;12(7) Ogarro LW.1997.ONION LEAF BLIGHT CAUSED BY XANTHOMONAS CAMPESTRIS - ALTERNATIVE HOSTS AND RESISTANT ONION GENOTYPES.Plant Disease ;81(9) Palmer, R. G., S. M. Lim, and B. R. Hedges Testing for linkage between the Rxp locus and nine isozyme loci in soybean. Crop Sci. 32:
93 Rukayadi Y.2000.Survival and epiphytic fitness of a nonpathogenic mutant of Xanthomonas campestris pv. glycines.applied & Environmental Microbiology.;66 (3): Seehous, K., and R. Tenhaken Cloning of genes by mrna differential display induced during the hypersensitive reaction of soybean after inoculation with Psedomonas syringae pv. glycinea. Plant Mol. Biol. 38: Song WY, Wang GL, Chen LL, Kim HS, Pi LY, Holsten T, Gardner J, Wang B, Zhai WX, Zhu LH, Fauquet C, Ronald P A receptor kinase-like protein encoded by the rice disease resistance gene, Xa21. Science 270: Virk, P. S., H. S. Pooni, N. H. Syed, and M. J. Kearsey Fast and reliable genotype validation using microsatellite markers in Arabidopsis thaliana. Theor. Appl. Genet. 98: Weber, C. R., J. M. Dunleavy, and W. R. Fehr Effect of bacterial pustule on closely related soybean lines. Agron. J. 58:
94 Yu, Y. G., M. A. Saghai Maroof, and G. R. Buss Divergence and allelomorphic relationship of a soybean virus resistance gene based on tightly linked DNA microsatellite and RFLP markers. Theor. Appl. Genet. 92:64-69.
95
96
97
Y 1 Y β α β Independence p qp pq q if X and Y are independent then E(XY)=E(X)*E(Y) so Cov(X,Y) = 0 Covariance can be a measure of departure from independence q Conditional Probability if A and B are
More information2 Journal of Agriculture & Life Science 47(5) Ⅰ. 서론콩 (Glycine max) 은우리나라를중심으로한동아 시아가원산지로서단백질식품으로의우수성이인정되면서세계적으로그소비가증가하고있는작물중의하나이며, 세계에서경제적으로도매우중요한작물중의
농업생명과학연구 47(5) pp.1-9 Journal of Agriculture & Life Science 47(5) pp.1-9 콩에서주당협수와주당립수및협당립수와관련된양적형질유전자좌분석 김현경 1 임후남 2 최영환 2 강점순 2 이용재 2 박영훈 2 서정민 3 손병구 2* 1 부산대학교의학연구원, 2 부산대학교원예생명과학과, 3 부산대학교바이오환경에너지학과
More information한국성인에서초기황반변성질환과 연관된위험요인연구
한국성인에서초기황반변성질환과 연관된위험요인연구 한국성인에서초기황반변성질환과 연관된위험요인연구 - - i - - i - - ii - - iii - - iv - χ - v - - vi - - 1 - - 2 - - 3 - - 4 - 그림 1. 연구대상자선정도표 - 5 - - 6 - - 7 - - 8 - 그림 2. 연구의틀 χ - 9 - - 10 - - 11 -
More informationCan032.hwp
Chromosomal Alterations in Hepatocellular Carcinoma Cell Lines Detected by Comparative Genomic Hybridization Sang Jin Park 1, Mahn Joon Ha, Ph.D. 1, Hugh Chul Kim, M.D. 2 and Hyon Ju Kim, M.D. 1 1 Laboratory
More information- i - - ii - - iii - - iv - - v - - vi - - 1 - - 2 - - 3 - 1) 통계청고시제 2010-150 호 (2010.7.6 개정, 2011.1.1 시행 ) - 4 - 요양급여의적용기준및방법에관한세부사항에따른골밀도검사기준 (2007 년 11 월 1 일시행 ) - 5 - - 6 - - 7 - - 8 - - 9 - - 10 -
More information09-감마선(dh)
Journal of Radiation Industry 4 (3) : 253~257 (2010) Review Paper 감마선 조사가 포인세티아의 발근, 생육 및 색상변이에 미치는 영향 이은경* 김원희 김성태 강시용 1 국립원예특작과학원, 1 한국원자력연구원 Rooting, Growth, and Color Mutation of Poinsettias Affected
More information학술원논문집 ( 자연과학편 ) 제 50 집 2 호 (2011) 콩의식품적의의및생산수급과식용콩의자급향상 李弘䄷 * 李英豪 ** 李錫河 *** * Significance of Soybean as Food and Strategies for Self Suffici
학술원논문집 ( 자연과학편 ) 제 50 집 2 호 (2011) 97-137 콩의식품적의의및생산수급과식용콩의자급향상 李弘䄷 * 李英豪 ** 李錫河 *** * Significance of Soybean as Food and Strategies for Self Sufficiency Improvement Hong Suk Lee*, Yeong-Ho Lee**, and
More information09È«¼®¿µ5~152s
Korean Journal of Remote Sensing, Vol.23, No.2, 2007, pp.45~52 Measurement of Backscattering Coefficients of Rice Canopy Using a Ground Polarimetric Scatterometer System Suk-Young Hong*, Jin-Young Hong**,
More information<B3EDB9AEC1FD5F3235C1FD2E687770>
오용록의 작품세계 윤 혜 진 1) * 이 논문은 생전( 生 前 )에 학자로 주로 활동하였던 오용록(1955~2012)이 작곡한 작품들을 살펴보고 그의 작품세계를 파악하고자 하는 것이다. 한국음악이론이 원 래 작곡과 이론을 포함하였던 초기 작곡이론전공의 형태를 염두에 둔다면 그의 연 구에서 기존연구의 방법론을 넘어서 창의적인 분석 개념과 체계를 적용하려는
More information012임수진
Received : 2012. 11. 27 Reviewed : 2012. 12. 10 Accepted : 2012. 12. 12 A Clinical Study on Effect of Electro-acupuncture Treatment for Low Back Pain and Radicular Pain in Patients Diagnosed with Lumbar
More information,,,.,,,, (, 2013).,.,, (,, 2011). (, 2007;, 2008), (, 2005;,, 2007).,, (,, 2010;, 2010), (2012),,,.. (, 2011:,, 2012). (2007) 26%., (,,, 2011;, 2006;
,,.. 400,,,,,,.,,, -, -, -., 3.. :, Tel : 010-9540-0640, E-mail : sunney05@hanmail.net ,,,.,,,, (, 2013).,.,, (,, 2011). (, 2007;, 2008), (, 2005;,, 2007).,, (,, 2010;, 2010), (2012),,,.. (, 2011:,, 2012).
More information- i - - ii - - iii - - iv - - v - - 1 - - 2 - - 3 - - 4 - - 5 - - 6 - - 7 - - 8 - - 9 - - 10 - - 11 - - 12 - - 13 - - 14 - - 15 - - 16 - - 17 - - 18 - - 19 - α α - 20 - α α α α α α - 21 - - 22 - - 23 -
More information1..
Volume 12, Number 1, 6~16, Factors influencing consultation time and waiting time of ambulatory patients in a tertiary teaching hospital Jee-In Hwang College of Nursing Science, Kyung Hee University :
More information(2)-02(최경자).fm
Res. Plant Dis. 16(2) : 148-152 (2010) Research in Plant Disease The Korean Society of Plant Pathology z w t w sƒ Á½ Á Á yá * w yw yw l Development of Effective Screening Method and Evaluation of Radish
More informationl l l l l l l l l Lee, Geon Kook None This project was designed to establish the Tumor Bank of National Cancer Center in 2000. From the first tumor sample in 2000, the total of tumor and tumor-related
More information(2)-14(김병수).fm
Res. Plant Dis. 16(2) : 141-147 (2010) Research in Plant Disease The Korean Society of Plant Pathology ü q š t w ½ *Á«k 1,2 Áy 1 Á Á Á xá½x w w, 1» š x, 2 x» t» x Resistance to Phytophthora Blight of Commercial
More information식물병연구 Research Article Open Access Res. Plant Dis. 24(3): (2018) Incidence Rates of Major Diseases o
식물병연구 Research Article Open Access Res. Plant Dis. 24(3): 175-181 (2018) https://doi.org/10.5423/rpd.2018.24.3.175 Incidence Rates of Major Diseases on Green-Fleshed Kiwifruit cv. Hayward and Yellow-Fleshed
More information- iii - - i - - ii - - iii - 국문요약 종합병원남자간호사가지각하는조직공정성 사회정체성과 조직시민행동과의관계 - iv - - v - - 1 - - 2 - - 3 - - 4 - - 5 - - 6 - - 7 - - 8 - - 9 - - 10 - - 11 - - 12 - - 13 - - 14 - α α α α - 15 - α α α α α α
More information서론
- i - - ii - - iii - - iv - - v - - vi - - 1 - - 2 - - 3 - - 4 - - 5 - - 6 - - 7 - - 8 - - 9 - - 10 - - 11 - - 12 - - 13 - - 14 - - 15 - - 16 - - 17 - - 18 - - 19 - - 20 - - 21 - - 22 - - 23 - - 24 - -
More information°ø±â¾Ð±â±â
20, 30, 40 20, 30, 40 1 2 3 4 5 6 7 8 9 10 3.1 6.3 9.4 12.6 15.7 18.8 22.0 25.1 28.3 31.4 2.4 4.7 7.1 9.4 11.8 14.1 16.5 18.8 21.2 23.6 7.1 14.1 21.2 28.3 35.3 42.4 49.5 56.5 63.6 70.7 5.9 11.9 17.8 23.7
More information212 Research in Plant Disease Vol. 20 No. 3., 7 (Kim, 2004). Colletotrichum (Park Kim, 1992),.. (Agrios, 2008)... 1,202, 256 92, 147, 11 (RDA, 2014).
식물병연구 Research Article Open Access Res. Plant Dis. 20(3) : 211-215(2014) http://dx.doi.org/10.5423/rpd.2014.20.3.211 Protective Activity of the Mixtures of Pine Oil and Copper Hydroxide against Bacterial
More information석사논문.PDF
ABO Rh A study on the importance of ABO and Rh blood groups information in Public Health 2000 2 1 ABO Rh A study on the importance of ABO and Rh blood groups information in Public Health 2000 2 2 ABO Rh
More informationstep 1-1
Written by Dr. In Ku Kim-Marshall STEP BY STEP Korean 1 through 15 Action Verbs Table of Contents Unit 1 The Korean Alphabet, hangeul Unit 2 Korean Sentences with 15 Action Verbs Introduction Review Exercises
More information44-4대지.07이영희532~
A Spatial Location Analysis of the First Shops of Foodservice Franchise in Seoul Metropolitan City Younghee Lee* 1 1 (R) 0 16 1 15 64 1 Abstract The foodservice franchise is preferred by the founders who
More information<31332E28C7B0C1BE29B9E8BCAEBAB92E687770>
韓 育 誌 (Korean J. Breed. Sci.) 40(2) : **~** (2008) 단경 내병 다수성 땅콩 품종 풍산 배석복 * 정영근 2 박장환 이명희 황정동 심강보 정찬식 강철환 박금룡 박충범 최규환 4 이재철 5 김인재 6 김제규 영남농업연구소, 2 호남농업연구소, 작물과학원, 4 전라북도노업기술원, 5 충청남도농업기술원, 6 충청북도 농업기술원,
More information605.fm
Journal of the Korean Housing Association Vol. 19, No. 6, 2008 y k y p w sƒ Care-giver s Needs and Evaluation on the Actual Condition of the Playgrounds in Child Care Facilities y* Choi, Mock-Wha x **
More informationJournal of Educational Innovation Research 2018, Vol. 28, No. 3, pp DOI: * Strenghening the Cap
Journal of Educational Innovation Research 2018, Vol. 28, No. 3, pp.27-43 DOI: http://dx.doi.org/10.21024/pnuedi.28.3.201809.27 * Strenghening the Capacity of Cultural Arts Required in Special Education
More informationChapter 26
11 주 RNA 합성 11.1 DNA-dependent synthesis of RNA: Bacteria에서의 transcription l RNA polymerase (5 subunits로구성 : 2α, β, β, σ) l 효소에의한 RNA 합성의특징 - Complementary sequence to template DNA - RNA chain의합성방향 : 5
More informationRheu-suppl hwp
Objective: This paper reviews the existing Korean medical and public health, and nursing academy articles on disease-specific and domain-specific quality of life, and provides recommendations for the universally
More information김범수
Analysis of Outcomes after Resection of Sarcomatous Hepatocellular Carcinoma Purpose: Sarcomatous hepatocellular carcinoma (HCC) is rare. Therefore, the clinicopathologic characteristics and prognosis
More informationMHC T cell Receptor Antigen Antigen-presenting cell Antigen-reactive T cell CD28 B7 Activation (proliferation Cytokine production Cytotoxicity) Antigen-presenting cell Antigen-reactive T cell Dormant State
More information도비라
광고학연구 : 제24권 5호(2013년) The Korean Journal of Advertising, Vol.24, No.5 (2013). pp.99 116 대학생 광고공모전이 광고업계 취업에 미치는 영향: 대학생과 실무자의 인식 비교를 중심으로 차 유 철 우석대학교 광고이벤트학과 교수, 언론학박사 이 희 복 상지대학교 언론광고학부 교수, 언론학박사* 신
More information03이경미(237~248)ok
The recent (2001-2010) changes on temperature and precipitation related to normals (1971-2000) in Korea* Kyoungmi Lee** Hee-Jeong Baek*** ChunHo Cho**** Won-Tae Kwon*****. 61 (1971~2000) 10 (2001~2010).
More informationLumbar spine
Lumbar spine CT 32 111 DOI : 10.3831/KPI.2010.13.2.111 Lumbar Spine CT 32 Received : 10. 05. 23 Revised : 10. 06. 04 Accepted : 10. 06. 11 Key Words: Disc herniation, CT scan, Clinical analysis The Clinical
More informationPharmacotherapeutics Application of New Pathogenesis on the Drug Treatment of Diabetes Young Seol Kim, M.D. Department of Endocrinology Kyung Hee Univ
Application of New Pathogenesis on the Drug Treatment of Diabetes Young Seol Kim, M.D. Department of Endocrinology Kyung Hee University College of Medicine & Hospital E mail : ycell2@yahoo.co.kr Abstract
More informationV V V α Azam, M. Z. M. & Park, Dong-Ho (2012). The relationship between Digit Ratio(2D:4D) and Physical Fitness in Children. Journal of Korean Society of Living Environmental System, 19(1), 101-110.
More informationAbstract Background : Most hospitalized children will experience physical pain as well as psychological distress. Painful procedure can increase anxie
Volume 12, Number 1, 92~102, An Intervention Study of Pain Reduction during IV Therapy in Hospitalized Children Myo-Jin Kim 1), Joung-Hae Bak 1), Won-Seok Seo 2) Mi-Young Kim 3), Sun-Kyoung Park 3), Jai-Soung
More information,......
The Impact of Personal Traits, Family Characteristics, and Job Satisfaction on the Psychological Well-Being of Middle Aged Men from the Baby Boomer Generation Working in Large Corporations Department of
More informationmau A B C Qsepharose051229manual001:1_UV@01,SHFT Qsepharose051229manual001:1_Conc Qsepharose051229manual001:1_Fractions Qsepharose051229manual001:1_Inject Manual run 3:1_UV@01,SHFT Manual run 3:1_Fractions
More information2009년 국제법평론회 동계학술대회 일정
한국경제연구원 대외세미나 인터넷전문은행 도입과제와 캐시리스사회 전환 전략 일시 2016년 3월 17일 (목) 14:00 ~17:30 장소 전경련회관 컨퍼런스센터 2층 토파즈룸 주최 한국경제연구원 한국금융ICT융합학회 PROGRAM 시 간 내 용 13:30~14:00 등 록 14:00~14:05 개회사 오정근 (한국금융ICT융합학회 회장) 14:05~14:10
More informationAnalyses the Contents of Points per a Game and the Difference among Weight Categories after the Revision of Greco-Roman Style Wrestling Rules Han-bong
Analyses the Contents of Points per a Game and the Difference among Weight Categories after the Revision of Greco-Roman Style Wrestling Rules Han-bong An 1 & Kyoo-jeong Choi 2 * 1 Korea National Wrestling
More informationÀ±½Â¿í Ãâ·Â
Representation, Encoding and Intermediate View Interpolation Methods for Multi-view Video Using Layered Depth Images The multi-view video is a collection of multiple videos, capturing the same scene at
More informationDBPIA-NURIMEDIA
27(2), 2007, 96-121 S ij k i POP j a i SEXR j i AGER j i BEDDAT j ij i j S ij S ij POP j SEXR j AGER j BEDDAT j k i a i i i L ij = S ij - S ij ---------- S ij S ij = k i POP j a i SEXR j i AGER j i BEDDAT
More information대한한의학원전학회지26권4호-교정본(1125).hwp
http://www.wonjeon.org http://dx.doi.org/10.14369/skmc.2013.26.4.267 熱入血室證에 대한 小考 1 2 慶熙大學校大學校 韓醫學科大學 原典學敎室 韓醫學古典硏究所 白裕相1, 2 *117) A Study on the Pattern of 'Heat Entering The Blood Chamber' 1, Baik 1
More information(000-000)실험계획법-머리말 ok
iii Design Analysis Optimization Design Expert Minitab Minitab Design Expert iv 2008 1 v 1 1. 1 2 1. 2 4 1. 3 6 1. 4 8 1. 5 12 2 2. 1 16 2. 2 17 2. 3 20 2. 4 27 2. 5 30 2. 6 33 2. 7 37 2. 8 42 46 3 3.
More information서론 34 2
34 2 Journal of the Korean Society of Health Information and Health Statistics Volume 34, Number 2, 2009, pp. 165 176 165 진은희 A Study on Health related Action Rates of Dietary Guidelines and Pattern of
More information` Companies need to play various roles as the network of supply chain gradually expands. Companies are required to form a supply chain with outsourcing or partnerships since a company can not
More information182 동북아역사논총 42호 금융정책이 조선에 어떤 영향을 미쳤는지를 살펴보고자 한다. 일제 대외금융 정책의 기본원칙은 각 식민지와 점령지마다 별도의 발권은행을 수립하여 일본 은행권이 아닌 각 지역 통화를 발행케 한 점에 있다. 이들 통화는 일본은행권 과 等 價 로 연
越 境 하는 화폐, 분열되는 제국 - 滿 洲 國 幣 의 조선 유입 실태를 중심으로 181 越 境 하는 화폐, 분열되는 제국 - 滿 洲 國 幣 의 조선 유입 실태를 중심으로 - 조명근 고려대학교 BK21+ 한국사학 미래인재 양성사업단 연구교수 Ⅰ. 머리말 근대 국민국가는 대내적으로는 특정하게 구획된 영토에 대한 배타적 지배와 대외적 자주성을 본질로 하는데, 그
More informationhwp
심사위원 심사위원 심사위원 인 인 인 - i - - ii - - iii - - iv - - v - Ⅰ. 서 - 1 - - 2 - - 3 - - 4 - - 5 - - 6 - - 7 - - 8 - - 9 - - 10 - - 11 - - 12 - - 13 - - 14 - - 15 - - 16 - - 17 - - 18 - 항목 건강하지못하다 주관적구강상태 보통이다
More informationJournal of Educational Innovation Research 2017, Vol. 27, No. 1, pp DOI: * The
Journal of Educational Innovation Research 2017, Vol. 27, No. 1, pp.243-268 DOI: http://dx.doi.org/10.21024/pnuedi.27.1.201703.243 * - 2001 2015 - The Research Trends on Peer Counseling in Elementary and
More informationΔ Epidermal growth factor receptor (EGFR) is well established target for cancer treatment and EGFR tyrosine kinase (TK) inhibitors such as gefinitib and elotinib have been developed as anti-cancer drugs.
More informationA
2009 4 A270412 < 차례> 1 요약 1 2 심사경위 2 3 심사경과 2 4 심사방법 3 5 심사신청자료검토 3 51 심사신청된식품의개요 3 52 식품으로의적합성검토 3 53 유전자재조합체의안전성 3 가 유전자재조합체의개발목적및이용방법에관한자료 3 나 숙주에관한자료 4 (1) 분류학적특성( 일반명 학명 계통분류등) 4 (2) 재배및품종개량의역사 4
More information<35335FBCDBC7D1C1A42DB8E2B8AEBDBAC5CDC0C720C0FCB1E2C0FB20C6AFBCBA20BAD0BCAE2E687770>
Journal of the Korea Academia-Industrial cooperation Society Vol. 15, No. 2 pp. 1051-1058, 2014 http://dx.doi.org/10.5762/kais.2014.15.2.1051 멤리스터의 전기적 특성 분석을 위한 PSPICE 회로 해석 김부강 1, 박호종 2, 박용수 3, 송한정 1*
More information- 3 - 1 10. 10. 12 1. 12 2. 12. 13 2 14 2.1 14 2.2 17 2.3 18 2.4 19 2.5 21 (1) 21 (2) DNA 23 (3) 24 (4) 16S rrna 25 (5) (Polymerase chain reaction, PCR) 26 (6) PCR Primer 27 2.6 28. / 28-4 - (1) Bioaerosol
More informationJournal of Educational Innovation Research 2017, Vol. 27, No. 3, pp DOI: : A basic research
Journal of Educational Innovation Research 2017, Vol. 27, No. 3, pp.379-404 DOI: http://dx.doi.org/10.21024/pnuedi.27.3.201709.379 : A basic research for the after-school forest activities program models:
More information<C7D1B9CEC1B7BEEEB9AEC7D03631C1FD28C3D6C1BE292E687770>
설화에 나타난 사회구조와 그 의미 23) 박유미 * 차례 Ⅰ. 문제제기 Ⅱ. 서사 내부의 사회구조 Ⅲ. 사회문제의 해결방식과 그 의미 Ⅳ. 설화와 후대전승과의 상관관계 Ⅴ. 결론 국문초록 삼국유사 의 조에는 왕거인 이야기와 거타지 이야기가 하나의 설화에 묶여 전하고 있는데, 두 이야기는 해결구조에서 차이를
More information386-390.hwp
386 HANYANG MEDICAL REVIEWS Vol. 29 No. 4, 2009 우리나라 미숙아의 통계와 의료비용 Statistics and Medical Cost of Preterm in Korea 윤혜선 을지대학교 노원을지병원 소아청소년과학교실 Hye Sun Yoon, M.D., Ph.D., Department of Pediatrics, Nowon
More information118 김정민 송신철 심규철 을 미치기 때문이다(강석진 등, 2000; 심규철 등, 2001; 윤치원 등, 2005; 하태경 등, 2004; Schibeci, 1983). 모둠 내에서 구성원들이 공동으 로 추구하는 학습 목표의 달성을 위하여 각자 맡은 역할에 따라 함께
과학교육연구지,37권 1호,pp.117-130(2013.5) Jour.Sci.Edu,Vol.37,No.1,pp.117-130(2013.5) 생물 학습을 위한 고등학생 소집단과 교사의 면담에서 나타나는 상호작용 유형 분석 김정민 송신철 1 심규철 2 * 환경생태교육연구소 1 경기신길고등학교 2 공주대학교 The Patterns of Interaction in
More information433대지05박창용
Recent Changes in Summer Precipitation Characteristics over South Korea Changyong Park* JaYeon Moon** Eun-Jeong Cha*** Won-Tae Yun**** Youngeun Choi***** 1958 2007 6 9 6 9 10 10 10 10 10 Abstract This
More information<B3EDB9AEC1FD5F3235C1FD2E687770>
경상북도 자연태음악의 소박집합, 장단유형, 전단후장 경상북도 자연태음악의 소박집합, 장단유형, 전단후장 - 전통 동요 및 부녀요를 중심으로 - 이 보 형 1) * 한국의 자연태 음악 특성 가운데 보편적인 특성은 대충 밝혀졌지만 소박집합에 의한 장단주기 박자유형, 장단유형, 같은 층위 전후 구성성분의 시가( 時 價 )형태 등 은 밝혀지지 않았으므로
More informationCrt114( ).hwp
cdna Microarray Experiment: Design Issues in Early Stage and the Need of Normalization Byung Soo Kim, Ph.D. 1, Sunho Lee, Ph.D. 2, Sun Young Rha, M.D., Ph.D. 3,4 and Hyun Cheol Chung, M.D., Ph.D. 3,4 1
More informationA Study on Married Female Immigrants Life Style and Marriage Satisfaction in Terms of Preparing Their Old Age in Chungcheongnam-do Department of Gerontology, Hoseo University Doctoral Student : Hi Ran
More informationJournal of Educational Innovation Research 2018, Vol. 28, No. 4, pp DOI: 3 * The Effect of H
Journal of Educational Innovation Research 2018, Vol. 28, No. 4, pp.577-601 DOI: http://dx.doi.org/10.21024/pnuedi.28.4.201812.577 3 * The Effect of Home-based Activities Using Traditional Fairy Tales
More information歯5-2-13(전미희외).PDF
The Korean Journal of Counseling 2004, Vol. 5, No. 2, 423-434,. 4 5 18 9, 9.,,,,,.,,, t-.. :,,, (,, 1996),.,,. (, 2001),... 88 98 2000, 88 12.5%(250 )98 35.6%(712 )2.8 (,,, 2001) (Corresponding Author)
More informationVol.259 C O N T E N T S M O N T H L Y P U B L I C F I N A N C E F O R U M
2018.01 Vol.259 C O N T E N T S 02 06 28 61 69 99 104 120 M O N T H L Y P U B L I C F I N A N C E F O R U M 2 2018.1 3 4 2018.1 1) 2) 6 2018.1 3) 4) 7 5) 6) 7) 8) 8 2018.1 9 10 2018.1 11 2003.08 2005.08
More information01-15(3)-12(최장경).fm
Res. Plant Dis. 15(3) : 165-169 (2009) Research in Plant Disease The Korean Society of Plant Pathology GM s ü š w Cucumber mosaic virus v y 1 Á y Á»x 1 Á * w w, 1 w y w Comparative Analysis of Coat Protein
More information27 2, 1-16, * **,,,,. KS,,,., PC,.,,.,,. :,,, : 2009/08/12 : 2009/09/03 : 2009/09/30 * ** ( :
27 2, 1-16, 2009. * **,,,,. KS,,,., PC,.,,.,,. :,,, : 2009/08/12 : 2009/09/03 : 2009/09/30 * ** (: jjhkim@cau.ac.kr) 2 한국교육문제연구제 27 권 2 호, 2009 Ⅰ.,. 2008 3,536, 10 99.9% (, 2008). PC,, (, 2007). (, 2008),.,
More information44-3대지.08류주현c
A Comparative Study on the Commuting Regional Type According to the Features of Foreigner Commuting Ju-Hyun Ryu* Abstract The purposes of this study are to identify many implications of commuting regional
More informationuntitled
3. 농업환경연구과 과제구분 기본연구 수행시기 전반기 연구과제 및 세부과제 수행 기간 소 속 책임자 농가에 적합한 부식성곤충 대량 사육기술 개발 12~ 13 농업환경연구과 곤충팀 이영혜 1) 부식성 곤충 먹이 제조 기술 개발 12~ 13 농업환경연구과 곤충팀 이영혜 색인용어 부식성곤충, 장수풍뎅이, 계통, 먹이제조 ABSTRACT In first check,
More information저작자표시 - 비영리 - 변경금지 2.0 대한민국 이용자는아래의조건을따르는경우에한하여자유롭게 이저작물을복제, 배포, 전송, 전시, 공연및방송할수있습니다. 다음과같은조건을따라야합니다 : 저작자표시. 귀하는원저작자를표시하여야합니다. 비영리. 귀하는이저작물을영리목적으로이용할
저작자표시 - 비영리 - 변경금지 2.0 대한민국 이용자는아래의조건을따르는경우에한하여자유롭게 이저작물을복제, 배포, 전송, 전시, 공연및방송할수있습니다. 다음과같은조건을따라야합니다 : 저작자표시. 귀하는원저작자를표시하여야합니다. 비영리. 귀하는이저작물을영리목적으로이용할수없습니다. 변경금지. 귀하는이저작물을개작, 변형또는가공할수없습니다. 귀하는, 이저작물의재이용이나배포의경우,
More information., (, 2000;, 1993;,,, 1994), () 65, 4 51, (,, ). 33, 4 30, 23 3 (, ) () () 25, (),,,, (,,, 2015b). 1 5,
* 4.,, 3,,, 3,, -., 3, 12, 27, 20. 9,,,,,,,,. 6,,,,,. 5,,,,.. * (2016),. (Corresponding Author): / / 303 Tel: 063-225-4496 / E-mail: jnj1015@jj.ac.kr ., (, 2000;, 1993;,,, 1994), 2000. 2015 () 65, 4 51,
More information(Exposure) Exposure (Exposure Assesment) EMF Unknown to mechanism Health Effect (Effect) Unknown to mechanism Behavior pattern (Micro- Environment) Re
EMF Health Effect 2003 10 20 21-29 2-10 - - ( ) area spot measurement - - 1 (Exposure) Exposure (Exposure Assesment) EMF Unknown to mechanism Health Effect (Effect) Unknown to mechanism Behavior pattern
More information(2)-13(김기덕).fm
Res. Plant Dis. 16(2) : 176-182 (2010) Research in Plant Disease The Korean Society of Plant Pathology g t, q» w sƒ ½y Á Á½ 2 Á yk 3 Á 4 Áy ³ 1 *Á½» ** š w w w, 1 w w, 2 û», 3 w, 4 w w Evaluation of Disease
More information8(3)-01.fm
w» wz, 8«3y(2006) Korean Journal of Agricultural and Forest Meteorology, Vol. 8, No. 3, (2006), pp. 125~131 2003 û šþ vw k y³á Á ûxáû «Á½» Á½ Á½ š w yû (2006 3 7 ; 2006 6 17 ) A Survey on Low Temperature
More informationJournal of Educational Innovation Research 2018, Vol. 28, No. 2, pp DOI: IPA * Analysis of Perc
Journal of Educational Innovation Research 2018, Vol. 28, No. 2, pp.45-72 DOI: http://dx.doi.org/10.21024/pnuedi.28.2.201806.45 IPA * Analysis of Perception and Needs on Teaching Competencies of Faculty
More information. 45 1,258 ( 601, 657; 1,111, 147). Cronbach α=.67.95, 95.1%, Kappa.95.,,,,,,.,...,.,,,,.,,,,,.. :,, ( )
. 45 1,258 ( 601, 657; 1,111, 147). Cronbach α=.67.95, 95.1%, Kappa.95.,,,,,,.,...,.,,,,.,,,,,.. :,, (402-751) 253 E-mail : yspark@inha.ac.kr ,. (, 2011),, 1980 5 49.9%, 4 (20.3%). 1985, 5 (39.0%), 4 (25.3%).
More informationhttp://www.kbc.go.kr/pds/2.html Abstract Exploring the Relationship Between the Traditional Media Use and the Internet Use Mee-Eun Kang This study examines the relationship between
More information슬라이드 제목 없음
물리화학 1 문제풀이 130403 김대형교수님 Chapter 1 Exercise (#1) A sample of 255 mg of neon occupies 3.00 dm 3 at 122K. Use the perfect gas law to calculate the pressure of the gas. Solution 1) The perfect gas law p
More information<352E20BAAFBCF6BCB1C5C320B1E2B9FDC0BB20C0CCBFEBC7D120C7D1B1B920C7C1B7CEBEDFB1B8C0C720B5E6C1A1B0FA20BDC7C1A120BCB3B8ED28313531323231292D2DB1E8C7F5C1D62E687770>
통계연구(2015), 제20권 제3호, 71-92 변수선택 기법을 이용한 한국 프로야구의 득점과 실점 설명 1) 김혁주 2) 김예형 3) 요약 한국 프로야구에서 팀들의 득점과 실점에 영향을 미치는 요인들을 규명하기 위한 연구를 하였 다. 2007년부터 2014년까지의 정규리그 전 경기 자료를 대상으로 분석하였다. 전방선택법, 후방 소거법, 단계별 회귀법, 선택법,
More information135 Jeong Ji-yeon 심향사 극락전 협저 아미타불의 제작기법에 관한 연구 머리말 협저불상( 夾 紵 佛 像 )이라는 것은 불상을 제작하는 기법의 하나로써 삼베( 麻 ), 모시( 苧 ), 갈포( 葛 ) 등의 인피섬유( 靭 皮 纖 維 )와 칠( 漆 )을 주된 재료
MUNHWAJAE Korean Journal of Cultural Heritage Studies Vol. 47. No. 1, March 2014, pp.134~151. Copyright 2014, National Research Institute of Cultural Heritage 심향사 극락전 협저 아미타불의 제작기법에 관한 연구 정지연 a 明 珍 素 也
More information(JBE Vol. 21, No. 1, January 2016) (Regular Paper) 21 1, (JBE Vol. 21, No. 1, January 2016) ISSN 228
(JBE Vol. 1, No. 1, January 016) (Regular Paper) 1 1, 016 1 (JBE Vol. 1, No. 1, January 016) http://dx.doi.org/10.5909/jbe.016.1.1.60 ISSN 87-9137 (Online) ISSN 16-7953 (Print) a), a) An Efficient Method
More informationMicrosoft Word - pv_0602.doc
1 씨감자 생산 체계와 바이러스병 검사 (화란체계를 중심으로) 함 영 일 대관령원예농협 기술자문위원 To whom correspondence should be addressed. E-mail :yih0512430@yahoo.co.kr 목 차 1. 서언 2. 화란 씨감자 생산단계와 검사 2.1. 보증된 씨감자의 중요성 2.1.1. 최소한의 질적 요구조건 2.1.2.
More information국립국어원 20010-00-00 발간등록번호 00-000000-000000-00 국어정책 통계 조사 및 통계 연보 작성 연구책임자 이순영 제 출 문 국립국어원장 귀하 국어정책 통계 조사 및 통계 연보 작성 에 관하여 귀 원과 체결한 연 구 용역 계약에 의하여 연구 보고서를 작성하여 제출합니다. 2010년 12월 2일 연구책임자: 이순영(고려대학교 국어교육과)
More informationDBPIA-NURIMEDIA
김진주 김수연. 초등학생대상장애이해교육에활용된동화에나타난장애인관분석. 특수교육, 2013, 제12권, 제2호, 135-160... 20.,,. 4.,,.,..... 주제어 : 장애이해교육, 동화, 장애인관 1. ( 1 ) Incheon Munhak Elementary School ( )(, E-mail: sooyoun@ginue.ac.kr) Dept. of
More informationResearch in Plant Disease Vol. 23 No (Han, 2009; Kim, 1998, 2016; Lee, 2011, 2013; Tran Kim, 2012)., Fusarium, Verticillium (Hwang, 2009). R. s
식물병연구 Research Article Open Access Res. Plant Dis. 23(3): 228-233 (2017) https://doi.org/10.5423/rpd.2017.23.3.228 Resistance to Bacterial Wilt of Rootstock Varieties of Tomato and Graft Compatibility
More information:,,.,. 456, 253 ( 89, 164 ), 203 ( 44, 159 ). Cronbach α= ,.,,..,,,.,. :,, ( )
:,,.,. 456, 253 ( 89, 164 ), 203 ( 44, 159 ). Cronbach α=.83.91.,.,,..,,,.,. :,, (402-751) 253 E-mail : yspark@inha.ac.kr ..,.,.,. Bandura(1997),.,,,,., (,,, 2009), (,,,, 2014).?.,,,.. Bandura (1995) (Resiliency
More informationECG & EP CASES Young-Keun On, MD, PhD Division of Cardiology, Department of Medicine Cardiac & Vascular Center, Samsung Medical Center Sungkyunkwan University School of Medicine, Seoul, Korea A case of
More informationJournal of Educational Innovation Research 2017, Vol. 27, No. 3, pp DOI: (NCS) Method of Con
Journal of Educational Innovation Research 2017, Vol. 27, No. 3, pp.181-212 DOI: http://dx.doi.org/10.21024/pnuedi.27.3.201709.181 (NCS) Method of Constructing and Using the Differentiated National Competency
More information,126,865 43% (, 2015).,.....,..,.,,,,,, (AMA) Lazer(1963)..,. 1977, (1992)
, -,,,.,,,. 6.. (LIRUIYAO),, E-mail : ruiyao24@hotmail.com :,, 26 E-mail : taehee@khu.ac.kr 2014 1400 180 6.. 2014 6,126,865 43% (, 2015).,.....,..,.,,,,,,. 1963 (AMA) Lazer(1963)..,. 1977, 1990. (1992)
More information<C7D1B1B9B1A4B0EDC8ABBAB8C7D0BAB85F31302D31C8A35F32C2F75F303132392E687770>
버스 외부 광고의 효과에 관한 탐색적 연구 : 매체 접촉률과 인지적 반응을 중심으로 1) 고한준 국민대학교 언론정보학부 조교수 노봉조 벅스컴애드 대표 이사 최근 몇 년 사이 옥외 광고나 인터넷 광고 등 BTL(Below the Line) 매체가 광고 시장에서 차지하 는 비중이 점점 높아지고 있다. 버스 외부 광고는 2004년 7월 서울시 교통체계개편 이후 이용자
More information확률과통계 강의자료-1.hwp
1. 통계학이란? 1.1 수학적 모형 실험 또는 증명을 통하여 자연현상을 분석하기 위한 수학적인 모형 1 결정모형 (deterministic model) - 뉴톤의 운동방정식 : - 보일-샤를의 법칙 : 일정량의 기체의 부피( )는 절대 온도()에 정비례하고, 압력( )에 반비례한다. 2 확률모형 (probabilistic model) - 주사위를 던질 때
More information제출문 - 2 -
제출문 - 2 - 요약문 - 3 - - 4 - - 5 - - 6 - - 7 - - 8 - - 9 - - 10 - - 11 - - 12 - - 13 - - 14 - - 15 - - 16 - - 17 - - 18 - - 19 - - 20 - - 21 - - 22 - - 23 - - 24 - - 25 - - 26 - - 27 - - 28 - - 29 - - 30
More information<352EC7E3C5C2BFB55FB1B3C5EBB5A5C0CCC5CD5FC0DABFACB0FAC7D0B4EBC7D02E687770>
자연과학연구 제27권 Bulletin of the Natural Sciences Vol. 27. 2013.12.(33-44) 교통DB를 이용한 교통정책 발굴을 위한 통계분석 시스템 설계 및 활용 Statistical analytic system design and utilization for transport policy excavation by transport
More informationA 617
Special Issue Diabetic Retinopathy Won Ki Lee, M.D. Department of Ophthalmology The Catholic University of Korea College of Medicine Kangnam St. Mary s Hospital E mail : wklee@catholic.ac.kr Abstract R
More informationMON89788
2009 2 < 차례> 1 요약서 1 2 심사경위 2 3 심사경과 2 4 심사방법 3 5 심사신청자료검토 3 51 심사신청된식품의개요 3 52 식품으로의적합성검토 3 53 유전자재조합체의안전성 3 가 유전자재조합체의개발목적및이용방법에관한자료 3 나 숙주에관한자료 3 (1) 분류학적특성( 일반명, 학명, 계통분류등) 3 (2) 재배및품종개량의역사 4 (3) 기지의독성또는알레르기유발성
More information歯1.PDF
200176 .,.,.,. 5... 1/2. /. / 2. . 293.33 (54.32%), 65.54(12.13%), / 53.80(9.96%), 25.60(4.74%), 5.22(0.97%). / 3 S (1997)14.59% (1971) 10%, (1977).5%~11.5%, (1986)
More information02¿ÀÇö¹Ì(5~493s
Korean Journal of Remote Sensing, Vol.22, No.6, 2006, pp.485~493 Estimation of Quantitative Precipitation Rate Using an Optimal Weighting Method with RADAR Estimated Rainrate and AWS Rainrate Hyun-Mi Oh,
More information<35BFCFBCBA2E687770>
주요개념 : 컴퓨터음란물 접촉자, 성지식, 성태도 남자중학생의 컴퓨터음란물 접촉자와 비접촉자간의 성지식과 태도의 차이 김 영 혜* 이 화 자** 정 향 미*** 1. 연구의 필요성 한국은 I. 서 론 1960 년대 이후부터 시작된 돌진적 산업화 ( 한 상진, 1996) 로 인하여 경제적 부흥을 이루어 집집마다 TV 수상기를 가질 수 있게 되었고 최근에는 PC보급율
More information저작자표시 - 비영리 - 변경금지 2.0 대한민국 이용자는아래의조건을따르는경우에한하여자유롭게 이저작물을복제, 배포, 전송, 전시, 공연및방송할수있습니다. 다음과같은조건을따라야합니다 : 저작자표시. 귀하는원저작자를표시하여야합니다. 비영리. 귀하는이저작물을영리목적으로이용할
저작자표시 - 비영리 - 변경금지 2.0 대한민국 이용자는아래의조건을따르는경우에한하여자유롭게 이저작물을복제, 배포, 전송, 전시, 공연및방송할수있습니다. 다음과같은조건을따라야합니다 : 저작자표시. 귀하는원저작자를표시하여야합니다. 비영리. 귀하는이저작물을영리목적으로이용할수없습니다. 변경금지. 귀하는이저작물을개작, 변형또는가공할수없습니다. 귀하는, 이저작물의재이용이나배포의경우,
More informationJkcs022(89-113).hwp
대한배뇨장애 및 요실금 학회지 J. Korean Continence Society 2004;8:89-113 Bristol Female Lower Urinary Tract Symptom 설문지의 한국어 번역 및 번역본의 언어 타당도 Seung-June Oh*, Hyung Geun Park*, Sung Hyun Paick, Won Hee Park and Myung-Soo
More information