16-15(3)-07(최장경).fm
|
|
- 진운 엽
- 7 years ago
- Views:
Transcription
1 Res. Plant Dis. 15(3) : (2009) Research in Plant Disease The Korean Society of Plant Pathology t (Lagenaria leucantha var. gourda) w IB m Cucumber mosaic virus Áy 1 Á»x 1 Á t 2 Á * w w, 1 w y w, 2 w w A Subgroup IB Isolate of Cucumber mosaic virus Isolated from Lagenaria leucantha var. gourda Sun Mi Oh, Jin Sung Hong 1, Ki Hyun Ryu 1, Gung Pyo Lee 2 and Jang Kyung Choi* Department of Applied Biology, Kangwon National University, Chuncheon , Korea 1 Division of Environment & Life Sciences, Seoul Women's University, Seoul , Korea 2 Division of Applied Plant Sciences, Chungang University, Ansung , Korea (Received on November 17, 2009; Accepted on December 7, 2009) An isolate of Cucumber mosaic virus (CMV), called as Lag-CMV, was identified from Lagenaria leucantha var. gourda showing mosaic symptom, and its properties was compared to Fny-CMV (subgroup IA) and As- CMV (subgroup IB) by host reaction in several indicator plants, dsrna analysis, RT-PCR analysis, restriction enzyme profile of the PCR products and nucleotide sequence of coat protein gene. Lag-CMV was similar to As-CMV used as a control CMV by the induced chlorotic spot on inoculated leaves and mosaic symptoms on upper leaves of N. tabacum. cv. Xanthi nc. In the cucumber and zucchini squash, Lag-CMV and As-CMV induced a mild mosaic symptoms than that of Fny-CMV. Size and shapes of local lesions on Chenophodium amaranticolor and Vigna unguiculata induced by Lag-CMV was similar those by Fny-CMV or As-CMV. In experiments of dsrna profiles and RT-PCR analysis of coat protein gene, Lag-CMV was come within subgroup I CMV. Moreover, restriction enzyme analysis using EcoRI, SalI, MspI, XhoI, and HindIII of the RT- PCR products and nucleotide sequence analysis of the coat protein gene showed that Lag-CMV belong to a member of CMV subgroup IB of the same to As-CMV. Keywords : Cucumber mosaic virus, Lagenaria leucantha var. gourda., Host reaction, Restriction enzyme profile, Subgroup IB Bromoviridae Cucumovirus w Cucumber mosaic virus(cmv), swš» ƒ vw š, ù y{ ƒ w š (Tomlinson, 1987). CMV RNA1, RNA2 RNA3 3 (+) ƒ RNA RNA3 3' w w RNA(RNA4) swwš (Palukaitis, 1992). ¾ š m CMV j I II š (Owen Palukaitis, 1988),» *Corresponding author Phone) , Fax) ) jkchoi@kangwon.ac.kr p x w (Kaper Waterworth, 1981), v rp ELISA(enzyme-linked immunosorbent assay) (Edwards Gonsalves, 1983), RNase protection w heterogenecity (Owen Palukaitis, 1988) RT-PCR(reverse transcription-polymerase chain reaction) w v wz (Rizos, 1992) w š. I w RNA3 5'» p k IA IB wš (Roossinck, 1999). t (Lagenaria leucantha var. gourda) (Lagenaria leucantha) w y. x
2 t (Lagenaria leucantha var. gourda) w IB m Cucumber mosaic virus 255 (KI /QUCKE U[ORVQOU KP PCVWTCNN[ KPHGEVGF.CIGPCTKC NGWECPVJCXCTIQWTFC wš w š. ¾ t š ù, l Cucumber mosaic virus(cmv) (Choi, 1999), Cucumber green mottle mosaic virus(cgmmv) (Lee, 1990; Kim Lee, 2000; Antignus, 2001), Zucchini yellow mosaic virus(zymv) (Lisa, 1981), Zucchini green mottle mosaic virus(zgmmv) (Ryu, 2000; Lee, 2003) y , w s x j t (Fig. 1) w g l CMV w m wš, ¾ t CMV m w p w. ¾. j t 0.01 M (ph 7.0) w z, 5-6» Nicotiana benthamiana w. 10 z N. benthamiana w t Cucumovirus p v (CPT-all primer) (Choi, 1999) w RT-PCR(reverse transcription-polymerase chain reaction)) w, 950 bp j» cdnaƒ. t j CMV w m w š Chenopodium amaranticolor w w. mw N. benthamiana C. amaranticolor w x 2z w, x 5-6» N. benthamiana w œ w š, t w CMV Lag- CMV w. wr CMV ¾ Fny-CMV( IA) As-CMV( IB) œ w. t. Lag-CMV» p w» w CMV p š N. tabacum cv. Xanthi nc, N, glutinosa, Cucubita pepo cv. Black beauty, Cucumis sativus cv. Suyo, Vigna unguiculata cv. Kurotanesanzaku Capsicum annuum cv. Cheongyang œ w. e 0.01 M w w, w t 25 o C-30 C 2 o š ùkù Fny-CMV As- CMV w t wì w. Lag-CMV Fny-CMV As-CMV» ùkù p Table 1 6CDNG4GCEVKQPQHKPFKECVQTRNCPVUD[OGEJCPKECNKPQEWNCVKQP QH.CI(P[CPF#U *QUVRNCPV.CI 5[ORVQOU C (P[ #U 0KEQVKCPCDGPVJCOKCPC / / / 0INWVKPQUC / / / 0VCDCEWOEX:CPVJKPE %5/ / %5/ %JGPQRQFKWOCOCTCPVKEQNQT... %CRUKEWOCPPWWOEX%JGQPI[CPI / O/ %WEWDKVCRGRQEX$NCEMDGCWV[ / %5/ / %WEWOKUUCVKXWUEX5W[Q / / / 8KIPCWPIWKEWNCVC... a Inoculated leaves/upper leaves, M: mosaic, mm: mild mosaic, CS: chlorotic spot, L: necrotic local lesion, -: symptom less or not infected. (KI5[ORVQOUQPKPFKECVQTRNCPVUD[OGEJCPKECNKPQEWNCVKQP QH.CI KUQNCVGF HTQO.CIGPCTKC NGWECPVJC XCT IQWTFC (P[ CPF #U YGTG KPQEWNCVGF CU C EQPVTQN U 2JQVQITCRJU CTG RTGUGPVGF QP KPQEWNCVGF NGCXGU QH 0KEQVKCPC VCDCEWOEX:CPVJKPECPFQPWRRGTNGCXGUQH%WEWOKUUCVKXWU EX 5W[Q %WEWTDKVC RGRQ EX $NCEM DGCWV[ CPF %CRUKEWO CPPWWOEX%JGQPI[CPITGURGEVKXGN[
3 256 Áy Á»xÁ tá w. t w Lag-CMV N. benthamiana x j ùkü œ w CMV w. ù N. tabacum. cv. Xanthi nc n x As-CMV w, ùkü Fny- CMV (Fig. 2). wr Fny-CMV j y w j ùkü, Lag-CMV As-CMV j x. š Fny-CMV As-CMVƒ 7~10 z j x ù, Lag-CMV y. ù Lag-CMV w š w Cucumovirus p v w RT-PCR w, cdnaƒ Lag-CMV š ƒ. wr C. amaranticolor V. unguiculata 2-3 z x CMV. DsRNA. Lag-CMV RNA j»» w Lag-CMV, Fny-CMV As-CMV N. benthamiana l Morris Dodds (1979) ƒ RNA(double stranded RNA; dsrna) w. w dsrna 6% polyacrylamide gel 1 TAE (40 mm Tris, 40 mm acetic acid, 2 mm EDTA, ph 7.8)» w z, ethidium bromide w w. Lag- CMV N. benthamiana l w dsrna» ql Fny-CMVù As-CMV dsrna j» ùkü (Fig. 3). dsrna wù CMV ƒ š, RNA satellite RNA w w (Dodds, 1993). w Wang (1988) m CMV l w dsrna», dsrna ƒ m x x(serotype) ew š šw. w š l w, Lag-CMV dsrna Fny-CMVù As-CMV x x q. RT-PCR wz. Lag-CMV N. benthamiana w total RNA wš, w RT-PCR w. Total RNA Choi (1998) w, RT-PCR v IR 3' sww Cucumovirus p v (Choi, 1999) w (KI 2QN[CET[NCOKFG IGN GNGEVTQRJQTGUKU QH FU40# KUQNCVGF HTQO0KEQVKCPCDGPVJCOKCPCKPHGEVGFYKVJ.CI#U CPF(P[TGURGEVKXGN[#NKSWQVQHFU40#RWTKHKGFD[%( EGNNWNQUGYCUGNGEVTQRJQTGUGFKPRQN[CET[NCOKFGIGN.» PCR 1.2% agarose gel 1 TAE» w, 3 CMV l 950 bp cdnaƒ (Fig. 4A). cdna wz EcoRI HindIII, MspI, SalI XhoI w z, wz ql(rflp) w Lag-CMV w. Lag-CMV RFLPql œ w 5 wz As-CMV ew Lag-CMVƒ IB (Fig. 4B). Singh (1995) CMV m w v cdna w EcoRI MspI w, I II w w š w. ù z w IA IB w. x HindIII IA IB CMV w» w wz ƒ. v p. Lag-CMV v w» w» w, CMV RNA3 v sww 950 bp cdna w. Lag-CMV CMV N. benthamiana l w total RNA x RT-PCR wwš, 1.2% agarose gel» w, ƒ CMV cdna w. w ƒ cdna pgem-t easy vector (Promega) ligation k z E. coli JM109 j w, GFX Micro Plasmid Prep kit (Amersham Parmacia) w w v w. w v wz EcoRI w y w, y v w» w. v» MacAlign(DNAstar 3.30C) w
4 t (Lagenaria leucantha var. gourda) w IB m Cucumber mosaic virus 257 (KI4GXGTUGVTCPUETKRVKQPRQN[OGTCUGEJCKPTGCEVKQP462%4CUUC[#CPFTGUVTKEVKQPGP\[OGCPCN[UKUQHVJGRTQFWEVU$HQTVJG JCNHTGIKQPQH40#EQXGTKPIHWNNNGPIVJEQCVRTQVGKPIGPGHTQO.CI#UCPF(P[TGURGEVKXGN[&KIGUVGFTGUVTKEVKQP HTCIOGPVUYGTGUGRCTCVGFQPCCITQUGIGNCPFUVCKPGFYKVJGVJKFKWODTQOKFG.CPG/MD&0#NCFFGTNCPG'EQ4+NCPG *KPF+++NCPG/UR+NCPG5CN+CPFNCPG:JQ+TGURGEVKXGN[ (KI%QORCTKUQPQHCOKPQCEKFUGSWGPEGQHEQCVRTQVGKPDGVYGGP.CI#UCPF(P[+FGPVKECNTGUKFWGUCTGKPFKECVGF D[J[RJGP w z ƒ w (Fig. 5).» Lag-CMV As-CMVƒ 99.1%, Lag-CMV Fny-CMV 94.5%,» w w Lag-CMV As-CMV 100%, Lag-CMV Fny-CMV 97.3%. Lag-CMV As- CMV 218 ew, Fny- CMV v 5 (25, 65, 71, 99, 205 ) ey ùkþ. t w Lag-CMV v As-CMV ew IB w CMV y. x j t (Lagenaria leucantha var. gourda) l CMV wš Lag-CMV w. t w Lag-CMV N. benthamiana x j ùkü œ w CMV w. ù N. tabacum. cv. Xanthi nc n x As-CMV w, ùkü Fny- CMV. w Fny-CMV j y w j ùkü, Lag-CMV As-CMV j x. š Fny-CMV As-CMV ƒ j x ù, Lag-CMV. Lag-CMV N. benthamiana l w dsrna» ql Fny- CMVù As-CMV dsrna j» ùkü. Lag-CMV N. benthamiana l w total RNA v IR 3' sww 950 bp cdnaw w v w RT-PCR w 950 bp cdnaƒ. cdna wz EcoRI, HindIII, MspI, SalI XhoI w z RFLP w, Lag-CMV RFLPql As-CMV ew. wr cdna w» w,» As-CMV 99.1%, Fny- CMV 94.5%, v As-CMV 100%, Fny-CMV 97.3% ùkþ. l t w Lag- CMV As-CMV IB w y.
5 258 Áy Á»xÁ tá ( y: ) w,. š x Antignus, Y., Wang, Y., Perlsman, M., Lachman, O., Lavi, N. and Gal-On, A Biological and molecular characterization of a new cucurbit-infecting Tobamovirus. Phtopathoiogy 91: Choi, J. K., Kim, H. J., Hong, J. S., Kim, D. W. and Lee, S. Y Identification and differentiation of cucumber mosaic virus isolates in Korea. Korean J. Plant Pathol. 14: Choi, S. K., Choi, J. K., Park, W. M. and Ryu, K. H RT- PCR detection and identification of three species of cucumoviruses with a genus-specific single pair of primers. J. Virol. Methods 83: Dodds, J. A DsRNA in diagnosis. In : Diagnosis of Plant Virus Diseases, ed. by R.E.F. Matthews. pp CRC Press, Boca Raton, USA. Edwards, M. C. and Gonsalves, D Grouping of seven biologically defined isolates of cucumber mosaic virus by peptide mapping. Phytopathology 73: Kim, D. H. and Lee, J. M Seed treatment for Cucumber green mottle mosaic virus (CGMMV) in gourd (Lagenaria siceraria) seeds and its detection. J. Kor. Soc. Hort. Sci. 44: 1-6. Kaper, J. M. and Waterworth, H. E Cucumoviruses. In : Handbook of Plant Virus Infections, ed. by E. Kurstak, pp Elsevier/Holland Biolmedical, New York, USA. Lee, G. P., Min, B.E., Kim, C. S., Choi, S. H., Ham, C. H., Kim, S. U. and Ryu, K. H Plant virus cdna chip hybridization for detection and differentiation of four cucubit-infecting tobamovirus. J. Virol. Methods 110: Lee, K. W., Lee, B. C., Park, H. C. and Lee, Y. S Occurrence of cucumber green mottle mosaic virus disease of watermelon in Korea. Korean J. Plant Pathol. 6: Lisa, V., Boccardo, G., Dgostino, G. and Dellavlle, G Characterization of a potyvirus causing zucchini yeiiow mosaic virus. Phytopathology 71: Morris, T. J. and Dodds, J. A Isolation and analysis of double-stranded RNA from virus-infected plant and fungal tissue. Phytopathology 69: Owen, J. and Palukaitis, P Characterization of cucumber mosaic virus. I. Molecular heterogenecity mapping of RNA3 in eight CMV strains. Virology 166: Palukaitis, P., Roossinck, M. J., Dietzgen, R. G. and Francki, R. I. B Cucumber mosaic virus. Adv. Virus. Res. 41: Rizos, H., Gunn, L. V., Pares, R. D. and Gillings, M. R Differentiation of cucumber mosaic virus isolates using the polymerase chain reaction. J. Gen. Virol. 73: Roossinck, M. J., Zhang, L. and Hellwald, K. H Rearrangement in the 5' nontranslated region and phylogenetic analysis of cucumber mosaic virus RNA3 indicated radial evolution of three subgroups. J. Virol. 73: Ryu, K. H., Min, B. E., Choi, G. S., Choi, S. H., Kwon, S. B., Noh, G. M., Yoon, J. Y., Choi, Y. M., Jang, S. H., Lee, G. P., Cho, K. H. and Park, W. M Zucchini green mottle mosaic virus is a new Tabamovirus; Comparison of its coat protein gene with that of Kyuri green mottle mosaic virus. Arch. Virol. 145: Singh, Z., Jones, R. A. C. and Jones, M. G. K Identification of Cucumber mosaic virus subgroup I isolates from banana plants affected by infectious chlorosis disease using RT-PCR. Plant Dis. 79: Tomlinson, J. A Epidemiology and control of virus diseases of vegetables. Ann. Appl. Biol. 110: Wang, W. Q., Natsuaki, T., Okuda, S. and Teranaka, M Comparison of cucumber mosaic virus isolate by duoblestrand RNA analysis. Ann Phytopath. Soc. Japan 54:
01-15(3)-12(최장경).fm
Res. Plant Dis. 15(3) : 165-169 (2009) Research in Plant Disease The Korean Society of Plant Pathology GM s ü š w Cucumber mosaic virus v y 1 Á y Á»x 1 Á * w w, 1 w y w Comparative Analysis of Coat Protein
More informationDBPIA-NURIMEDIA
식물병연구 Res. Plant Dis. 17(2) : 211 215 (2011) http://dx.doi.org/10.5423/rpd.2011.17.2.211 단보 Open Access Research in Plant Disease The Korean Society of Plant Pathology 열무에서분리한오이모자이크바이러스분리주의특성 이선주 홍진성 1
More information식물병연구 Note Open Access Res. Plant Dis. 24(1): (2018) 3 Detection and Identification of a Mixed Infectio
식물병연구 Note Open Access Res. Plant Dis. 24(1): 81-85 (2018) https://doi.org/10.5423/rpd.2018.24.1.81 3 Detection and Identification of a Mixed Infection of Three Viruses in Chinese Artichoke in Korea *
More information10(3)-09.fm
w y wz 10«3y 253~258 (2010.12.) Journal of Korean Society of Urban Environment ³ w Á» Á Á y w y œw (2010 11 22, 2010 12 9 k) Study on Determine of Detention Pond in Small Developed Area In-Soo Chang ½
More information03-15(3)-04(고숙주).fm
Res. Plant Dis. 15(3) : 175-182 (2009) Research in Plant Disease The Korean Societ of Plant Patholog ZYMV»ƒ e w š *Á½ Á Á½ šá 1 Á 1 û» e, 1 w Effect of the Infection Times b Zucchini ellow mosaic virus
More information10(3)-02.fm
w y wz 10«3y 203~211 (2010.12.) Journal of Korean Society of Urban Environment w ù p yá k«áyw *Á xá½k w y œw Á* y w (2010 9 15, 2010 12 2 k) Characterization of Nonpoint Source Pollutant Loads from the
More information14.531~539(08-037).fm
G Journal of the Korea Concrete Institute Vol. 20, No. 4, pp. 531~539, August, 2008 š x y w m š gj p { sƒ z 1) * 1) w w Evaluation of Flexural Strength for Normal and High Strength Concrete with Hooked
More information384 Research in Plant Disease Vol. 23 No. 4,, 1. (INSV),,, (vein clearing), (Tomato spotted wilt virus, TSWV),.,,,,,, (Brisco-McCann Hausbeck, 2016; S
식물병연구 Note Open Access Res. Plant Dis. 23(4) : 383-387 (2017) https://doi.org/10.5423/rpd.2017.23.4.383 First Report of Impatiens necrotic spot virus in Hoya carnosa in Korea 1 2 1 1 1 3 1 * 1, 2, 3 *Corresponding
More information12.077~081(A12_이종국).fm
J. of Advanced Engineering and Technology Vol. 1, No. 1 (2008) pp. 77-81 y w» e wx Á w œw Fabrication of Ceramic Batch Composition for Porcelain by Using Recycled Waste Ceramic Powder Hyun Guen Han, and
More information16(2)-7(p ).fm
w wz 16«2y Kor. J. Clin. Pharm., Vol. 16, No. 2. 2006 ü t xy y w tœ ½ BÁ x BC B y w w w C y w w w Current Status and Expectations of Orphan Drugs in Korea -In point of supplying medicines for the rare
More information10(3)-12.fm
w y wz 10«3y 273~280 (2010.12.) Journal of Korean Society of Urban Environment p yá xá½k w y œw (2010 9 15, 2010 12 2 k) Analysis of Characteristics of Delivered Nonpoint Source Pollution at Forested Watershed
More information82-01.fm
w y wz 8«( 2y) 57~61, 2005 J. of the Korean Society for Environmental Analysis p w w Á Á w w» y l Analysis of Influence Factors and Corrosion Characteristics of Water-pipe in Potable Water System Jae Seong
More information10(3)-10.fm
w y wz 10«3y 259~264 (2010.12.) Journal of Korean Society of Urban Environment w gj p p y Á Á½k * w m œw Á* w y œw (2010 9 28, 2010 10 12 k) Characteristics of Antiwashout Underwater Concrete for Reduction
More information9(3)-4(p ).fm
w wz J. Kor. Soc. Cloth. Ind. 9«3y, 2007 Vol. 9, No. 3, pp.319-326(2007) w xk x p w q w Analysis of Foot Characteristics According to the Classification of Foot Types of Junior High School Girls Ji-Young
More information<30332DB9E8B0E6BCAE2E666D>
kœw» y w k p y w k» z wš ye z w mdkqvqrg üœ» y» Ÿ w kœwgeqgpikpggtkpiy glj GEQVGEJPQNQI[ œw w k w yz š y j œ w m w y ˆ mw y» kœ w k û ³ y ƒ ƒ» ƒ w œw w w y ƒƒ» k z w» %NGCP 9CVGT #EV wšw y ù» œ w w w t
More information< DC1A4C3A5B5BFC7E22E666D>
¼ (Jeong, Jung Chae)*, ý (Kim, Yoon Soo), (Shin, Woo Young), Þ Ñ (Park, Jong Man) ò ý ƒ Ð (Korea Evaluation Institute of Industrial Technology) (Shin, Jae-Heyg) Š æ (Ministry of Knowledge Economy) 1. :
More information식물병연구 Note Open Access Res. Plant Dis. 20(4) : (2014) Brugmansia mosaic virus Characterization of B
식물병연구 Note Open Access Res. Plant Dis. 20(4) : 307-313(2014) http://dx.doi.org/10.5423/rpd.2014.20.4.307 Brugmansia mosaic virus Characterization of Brugmansia mosaic virus Isolated from Brugmansia spp.
More information(2)-02(최경자).fm
Res. Plant Dis. 16(2) : 148-152 (2010) Research in Plant Disease The Korean Society of Plant Pathology z w t w sƒ Á½ Á Á yá * w yw yw l Development of Effective Screening Method and Evaluation of Radish
More information605.fm
Journal of the Korean Housing Association Vol. 19, No. 6, 2008 y k y p w sƒ Care-giver s Needs and Evaluation on the Actual Condition of the Playgrounds in Child Care Facilities y* Choi, Mock-Wha x **
More information<30312DC0CCC7E2B9FC2E666D>
균류의다양성과역할 이향범 û w œw 머리말 k w š ³ q š yw < Ð >» w ww k w w v š q w Á Á w tyw š 2QKPVKPI CPF *[FG ú ƒ x %QPXGPVKQP QP $KQNQIKECN &KXGTUKV[ %$&» w w ««wš y w» š x ƒ w œ ƒ» ƒ œsw w ³ wš ù š y š ƒ t š ƒ wš»ƒ
More informationfm
[ ] w wz DOI: 10.3740/MRSK.2009.19.12.692 Kor. J. Mater. Res. Vol. 19, No. 12 (2009) y INCONEL 718w Gas Tungsten Arc Welding» p sƒ ½»y Á *Á *Á y** ( ) d lj p wœq, *w wœ» q **( ) d lj p t Mechanical Properties
More information16(1)-3(국문)(p.40-45).fm
w wz 16«1y Kor. J. Clin. Pharm., Vol. 16, No. 1. 2006 x w$btf3fqpsu'psn û w m w Department of Statistics, Chonnam National University Eunsik Park College of Natural Sciences, Chonnam National University
More information304.fm
Journal of the Korean Housing Association Vol. 20, No. 3, 2009 yw s w - û - A Study on the Planning of Improved-Hanok - Focused on Jeon-Nam Province - y* ** z*** **** Kang, Man-Ho Lee, Woo-Won Jeong, Hun
More information69-1(p.1-27).fm
99 A 380 B 787 : wœ z w * w w wœ» A380 B787 wœ» w. wœ» ww r. w wœ» p j y w r» w. I. II. z III. A380 B787 IV. A380 V. wœ» : x VI. z VII. I. A380 B787»ƒ z wœ w, w w p j w w ƒ r. t wœ w ƒ w w wœ» š œm wš,
More information50(5)-07.fm
Printed in the Republic of Korea w 3w yû x w w w Á x* w w w yw (2006. 3. 14 ) A research of the Difference in Teaching Styles and Understanding of 9 th Grade Students About Lead-iodide Precipitation Reaction
More information19(1) 02.fm
Korean J. Crystallography Vol. 19, No. 1, pp.7~13, 2008 Ÿ (ICISS) w š t w (2): t w y w œw Surface Structure Analysis of Solids by Impact Collision Ion Scattering Spectroscopy (2): Atomic Structure of Semiconductor
More information50(1)-09.fm
2006, Vol. 50, No. 1 Printed in the Republic of Korea 언빨래가마르는현상에대한중등학교화학전공교사들의인식조사 ½x Á» Á½ # Á x* w w yw y š w w # w w (2005. 5. 11 ) A Research of Secondary School Chemistry Major Teachers Perceptions
More informationCloning
Takara 와함께하는 Cloning 2014-11-13 다카라코리아바이오메디칼 목차 Cloning 이란? Cloning Flow Chart Cloning DNA / RNA 추출 High Fidelity PCR 제한효소 /ligation/e.coli 형질전환 Clone 확인 이것만은꼭!!! 2 Cloning 이란? Clone 세포나개체의증식에의해서생긴유전적으로동일한세포군
More information17.393~400(11-033).fm
Journal of the Korea Concrete Institute Vol. 23, No. 3, pp. 393~400, June, 2011 GGGGG DOI 10.4334/JKCI.2011.23.3.393 x RC { sƒ y y 1) *Á½ 1) Á 2) 1) y w œw 2) w œw Bond Strength Evaluation of RC Beams
More information인문사회과학기술융합학회
Vol.5, No.5, October (2015), pp.471-479 http://dx.doi.org/10.14257/ajmahs.2015.10.50 스마트온실을 위한 가상 외부기상측정시스템 개발 한새론 1), 이재수 2), 홍영기 3), 김국환 4), 김성기 5), 김상철 6) Development of Virtual Ambient Weather Measurement
More information03-2ƯÁý -14š
Management on hazardous chemicals for production of safe produce Namjun Cho, Sumyeong Hong, Wonil Kim, Byungjun Park Chemical Safety Division, National Academy of Agricultural Science, RDA * Correspondence
More information82.fm
Journal of the Korean Ceramic Society Vol. 44, No. 9, pp. 524~528, 2007. Determination of Critical Chloride Content of Ordinary Portland Cement Concrete by Linear Polarization Technique Hong-Sam Kim, Hai-Moon
More information49(6)-06.fm
Journal of the Korean Chemical Society 2005, Vol. 49, No. 6 Printed in the Republic of Korea 중학교과학교과서불꽃반응실험에서선스펙트럼관찰의문제점분석및개선연구 ½ Á Á * w w yw (2005. 10. 4 ) An Analysis and Improvement of the Line Spectrum
More information09-감마선(dh)
Journal of Radiation Industry 4 (3) : 253~257 (2010) Review Paper 감마선 조사가 포인세티아의 발근, 생육 및 색상변이에 미치는 영향 이은경* 김원희 김성태 강시용 1 국립원예특작과학원, 1 한국원자력연구원 Rooting, Growth, and Color Mutation of Poinsettias Affected
More informationuntitled
[ ] œwz, 21«6y(2008) J. of the Korean Society for Heat Treatment, Vol. 21, No. 6, (2008) pp. 300~306 š y w p x*, **Á **Áy y* * ** w œ w œw, w» gœ Solid State Diffusion Brazing of the Aluminum Alloy Castings
More information93.fm
Journal of the Korean Ceramic Society Vol. 45, No. 10, pp. 625~630, 2008. Effect of Storage Conditions on the Setting Properties of Brushite Bone Cement Containing Granular β-tricalcium Phosphate Sun-Ae
More information12(2)-04.fm
J. Korean. Soc. Living. Environ. Sys. Vol. 12, No. 2, pp 106~111(2005) w y y w z œ k üœ» p ½ Á Á Á ³ Á Á½Ÿ w w w, *g», ** w w Effects of Strategies to Improve Indoor Air Quality at Pre-occupancy Stage
More informationDBPIA-NURIMEDIA
Printed in the Republic of Korea "/"-:5*$"- 4$*&/$& 5&$)/0-0(: Vol. 18, No. 5, 425-430, 2005» 677*4 Ÿ w sƒ ½»x Á Á½ k w y w, w y œw Some considerations for the analytical approaches to measure atmospheric
More information01 Buffers & Gel Stain Buffers 3 Gel Stain SilverStar Staining Kit 6
Buffers & Gel Stain Chemicals Buffers & Chemicals Phone: 1588-9788 (ext.4->2) Email: reagents-support@bioneer.co.kr 01 Buffers & Gel Stain Buffers 3 Gel Stain SilverStar Staining Kit 6 Buffers Overview
More informationuntitled
3. 농업환경연구과 과제구분 기본연구 수행시기 전반기 연구과제 및 세부과제 수행 기간 소 속 책임자 농가에 적합한 부식성곤충 대량 사육기술 개발 12~ 13 농업환경연구과 곤충팀 이영혜 1) 부식성 곤충 먹이 제조 기술 개발 12~ 13 농업환경연구과 곤충팀 이영혜 색인용어 부식성곤충, 장수풍뎅이, 계통, 먹이제조 ABSTRACT In first check,
More information<283732372D3733312920B4D9C3CAC1A120BCD2C7C1C6AEC4DCC5C3C6AEB7BBC1EEC0C720B3EBBEC8C0C720BDC3B7C2BAB8C1A4BFA120B4EBC7D120C0AFBFEBBCBA20C6F2B0A1283035292E687770>
대한안과학회지 제 49 권 제 5 호 2008 J Korean Ophthalmol Soc 49(5):727-731, 2008 DOI : 10.3341/jkos.2008.49.5.727 다초점 소프트콘택트렌즈의 노안의 시력보정에 대한 유용성 평가 김현경 1 김효명 2 정성근 1 가톨릭대학교 의과대학 성모병원 안과학교실 1, 고려대학교 의과대학 안암병원 안과학교실
More information416.fm
Journal of the Korean Housing Association Vol. 20, No. 4, 2009 œ qp œ y An Analysis of Change on the Apartment Unit Plans and the Interior Spaces Related to Women * Choi, ByungSook ** Park, JungA "CTUSBDU
More information41(6)-09(김창일).fm
269 Ar v Na 0.5 K 0.5 NbO 3 t ½ t,, ½ w,, ½ w»œw Surface Reaction of Na 0.5 K 0.5 NbO 3 Thin Films in Inductively Coupled Ar Plasma w t œwz J. Kor. Inst. Surf. Eng. Vol. 41, No. 6, 2008. < > Dong-Pyo Kim,
More information15.101~109(174-하천방재).fm
w wz 8«4y 2008 8 pp. 101 ~ 109 w» m -,, - A Study on Warnning Criteria Investigation of Automated Rainfall Warning System -Focused on Realationship of Water Level, Discharge and Precipitation - Á Á Á Ahn,
More information14.fm
Journal of the Korean Ceramic Society Vol. 44, No. 2, pp. 93~97, 2007. Preparation of High Purity Si Powder by SHS Chang Yun Shin, Hyun Hong Min, Ki Seok Yun, and Chang Whan Won Engineering Research Center
More information식물병연구 Note Open Access Res. Plant Dis. 22(1): (2016) 서향에서분리한신종포티바이러스 (Daphne Mottle Virus) 의동정 Identi
식물병연구 Note Open Access Res. Plant Dis. 22(1): 59-63 (2016) http://dx.doi.org/10.5423/rpd.2016.22.1.59 서향에서분리한신종포티바이러스 (Daphne Mottle Virus) 의동정 Identification of Daphne Mottle Virus Isolated from Daphne
More information11(5)-12(09-10)p fm
w wz J. Kor. Soc. Cloth. Ind. 11«5y, 2009 Vol. 11, No. 5, pp.799-807(2009) w w * k ƒm w pg p w, ƒm w q w A Qualitative Research on Pursuing Image and Appearance Management Behavior of Brides Eun-Joo Bae
More information???? 1
The Korean Journal of Applied Statistics (2013) 26(1), 201 208 DOI: http://dx.doi.org/10.5351/kjas.2013.26.1.201 A Note on Model Selection in Mixture Experiments with Process Variables Jung Il Kim a,1
More information43(5)-1.fm
w œwz, 43«5y 2006 Textile Science and Engineering Vol. 43, No. 5, 2006 용융블렌드를이용한 PLA/PEG 블록공중합체의제조 Á w œw k Preparation of PLA/PEG Block Copolymer via Melt Blend %JGQN 5QQ ;QQP CPF &QPI 5WP,K 8q g yq r
More informationDBPIA-NURIMEDIA
식물병연구 Res. Plant Dis. 17(2) : 196 204 (2011) http://dx.doi.org/10.5423/rpd.2011.17.2.196 보문 Open Access Research in Plant Disease The Korean Society of Plant Pathology 2006 년과 2007 년상주와구례에서발생한오이바이러스병의병징특성
More informationuntitled
ª Œª Œ 27ƒ 2B Á 2007 3œ pp. 193 ~ 199 ª ƒ w d w ƒ sƒ Methodology of Drought Assessment Using National Groundwater Monitoring Network Data «x Á½ Kwon, Hyung JoongÁKim, Seong Joon Abstract The objective
More information10.063~070(B04_윤성식).fm
J. of Advanced Engineering and Technology Vol. 1, No. 1 (2008) pp. 63-70 Mg-3%Al-1%Zn w ƒœ» y Á x*á **Á Á w œw *w s l I ûer ** t Effect of Thermomechanical Treatment on Microstructure and Mechanical Properties
More informationw w l v e p ƒ ü x mw sƒw. ü w v e p p ƒ w ƒ w š (½kz, 2005; ½xy, 2007). ù w l w gv ¾ y w ww.» w v e p p ƒ(½kz, 2008a; ½kz, 2008b) gv w x w x, w mw gv
ª Œª Œ 30ƒ 5A Á 2010 9œ pp. 475 ~ 484 gj p ª v e p p PSC ƒ gv : II. x w Precast Concrete Copings for Precast Segmental PSC Bridge Columns : II. Experiments and Analyses ½kzÁ½ Á zá x Kim, Tae-HoonÁKim,
More information10(1)-08.fm
w y wz 10«( 1y) 47~52, 2007 J. of the Korean Society for Environmental Analysis œ w t y ½ xá Á x Á½ Á x* Ÿ œ, * w œw Optimization of Coagulation In The Conventional Water Treatment Plant Jun-Hyun Kim,
More information316 Research in Plant Disease Vol. 21 No. 4, (Seo, 2009). Enzyme-Linked Immuno Sorbent Assay(ELISA) Reverse Transcription- Polymerase Chain Reaction(R
식물병연구 Research Article Open Access Res. Plant Dis. 21(4) : 315-320(2015) http://dx.doi.org/10.5423/rpd.2015.21.4.315 Reverse transcription Loop-mediated isothermal amplification Soybean mosaic virus Detection
More informationKor. J. Aesthet. Cosmetol., 및 자아존중감과 스트레스와도 밀접한 관계가 있고, 만족 정도 에 따라 전반적인 생활에도 영향을 미치므로 신체는 갈수록 개 인적, 사회적 차원에서 중요해지고 있다(안희진, 2010). 따라서 외모만족도는 개인의 신체는 타
RESEARCH ARTICLE Kor. J. Aesthet. Cosmetol., 20-40대 여성의 외모만족도가 미용관리태도에 미치는 영향 홍수남 1, 김효숙 2 * 1 건국대학교 뷰티사이언스디자인학과, 2 건국대학교 의상디자인과 Effects of Extrinsic Body Satisfaction on Beauty Management Behavior of
More informationStatistical Data of Dementia.
Screening of Prolyl Endopeptidase Inhibitors from Medicinal Plants. Lee Si-young, Lee Jung-han, Paik Young-Sook College of Environment and Applied Chemistry, Kyung Hee University. Statistical Data of Dementia.
More information8(2)-4(p ).fm
w wz J. Kor. Soc. Cloth. Ind. 8«2y, 2006 Vol. 8, No. 2, pp.177-182(2006) x w e w 1) Á Ÿ 1) Á»û 2) 1) ƒm w q w 2) w w w The Effect of Media on Taking Plastic Surgery Chong-Hee Yun 1), Su-Kwang Sung 1) and
More informationLumbar spine
Lumbar spine CT 32 111 DOI : 10.3831/KPI.2010.13.2.111 Lumbar Spine CT 32 Received : 10. 05. 23 Revised : 10. 06. 04 Accepted : 10. 06. 11 Key Words: Disc herniation, CT scan, Clinical analysis The Clinical
More information06.177~184(10-079).fm
Journal of the Korea Concrete Institute Vol. 23, No. 2, pp. 177~184, April, 2011 GGGGG DOI 10.4334/JKCI.2011.23.2.177 x w w MRS w p s y 1) Á z 2) Á x 3) * 1) wû w œw 2) w œw 3) w Nonlinear Analysis for
More information09권오설_ok.hwp
(JBE Vol. 19, No. 5, September 2014) (Regular Paper) 19 5, 2014 9 (JBE Vol. 19, No. 5, September 2014) http://dx.doi.org/10.5909/jbe.2014.19.5.656 ISSN 2287-9137 (Online) ISSN 1226-7953 (Print) a) Reduction
More information31(3B)-07(7055).fm
ª Œª Œ 31ƒ 3B Á 2011 5œ pp. 265 ~ 276 ª w w s³ The Correlation Between the Moving Average of Precipitation and Groundwater Level in Korea Á½û» Yang, Jeong-SeokÁKim, Nam-Ki Abstract Precipitation data and
More information<30352DB1E2C8B9C6AFC1FD2028C8ABB1E2C7F6292036302D36362E687770>
3D 나노-마이크로 프린팅 기술의 현황 홍 기 현 한국기계연구원 부설 재료연구소 표면기술 연구본부 3D Nano-micro Printing Technology Kihyon Hong Korea Institute of Materials Science, Gyeongnam 642-831, Korea Abstract: 최근 3D 프린팅 기술을 이용하여 마이크로, 나노
More information01.01~08(유왕진).fm
JOURNAL OF KOREA SOCIETY OF PACKAGING SCIENCE & TECHNOLOGY. Vol. 14, No. 1 1~8 (2008) s w Á w» w Comparative Study on the Changes and Prospects of Flexible Food Packaging Design Kyung Soo Noh and Wang
More informationCan032.hwp
Chromosomal Alterations in Hepatocellular Carcinoma Cell Lines Detected by Comparative Genomic Hybridization Sang Jin Park 1, Mahn Joon Ha, Ph.D. 1, Hugh Chul Kim, M.D. 2 and Hyon Ju Kim, M.D. 1 1 Laboratory
More information12(3) 10.fm
KIGAS Vol. 12, No. 3, September, 2008 (Journal of the Korean Institute of Gas) ü LP ƒ š Database w š Á Á½z w ywœw (2008 6 10, 2008 8 12 (1 ), 2008 9 5 (2 ), 2008 9 5 k) Constructing a Database Structure
More informationuntitled
6ƒ 3A Á 006 5œ pp. 497 ~ 5 ª sƒ w k w w Improved Modal Pushover Analysis of Multi-span Continuous Bridge Structures z Áy Á½ Kwak, Hyo-GyoungÁHong, Seong JinÁKim, Young Sang Abstract In this paper, a simple
More information( )-83.fm
Journal of the Korean Ceramic Society Vol. 8, No. 1, pp. 0~5, 011. DOI:10.191/KCERS.011.8.1.00 Solidification of Heavy Metal Ions Using Magnesia-phosphate Cement HunG Choi, Hyun Ju Kang, Myung Shin Song,
More information50(4)-10.fm
2006, Vol. 50, No. 4 Printed in the Republic of Korea 칼코겐이도핑된망간산화물의저온합성연구 k Á z Á, *Áy, * y w ù w yw x ù l w» ww (2006. 7. 13 ) Chimie Douce Synthesis of Chalcogen-Doped Manganese Oxides Seung Tae Lim,GDae
More information04-46(1)-06(조현태).fm
w œwz, 46«1y 2009 Textile Science and Engineering Vol. 46, No. 1, 2009 ù 2'6 wx xk Á «w œ w» Áq œw k 1PG $CVJ1PG 5VGR &[GKPI H 0[NP2'6 5RNKV 6[RG /KETHKDGT *[GP 6CG %J CPF%JWN-YP2CTM &GRCTVOGPV H 1TICPKE
More informationmau A B C Qsepharose051229manual001:1_UV@01,SHFT Qsepharose051229manual001:1_Conc Qsepharose051229manual001:1_Fractions Qsepharose051229manual001:1_Inject Manual run 3:1_UV@01,SHFT Manual run 3:1_Fractions
More information16(5)-03(56).fm
Journal of Korean Powder Metallurgy Institute DOI: 10.4150/KPMI.2009.16.5.316 ƒ w Fe œ w Cu wy SPS (I) I. ƒ wy y Á xá½ Á½ *Á½{ a w œw, a w» gœ Production of Fe Amorphous Powders by Gas-atomization Process
More information슬라이드 1
EVENT 퀴아젠인기상품연말특별가전 200203 Top Taq DNA Polymerase (250U) 90,000 72,000 200205 Top Taq DNA Polymerase (1000U) 331,000 281,350 200403 Top Taq Master Mix Kit(250U) 104,000 83,200 201203 Taq DNA Polymerase
More information51(4)-13.fm
Journal of the Korean Chemical Society 2007, Vol. 51, No. 4 Printed in the Republic of Korea w x - w y *Á š w w w yw (2007. 3. 28 ) Case Study on Verbal Interactions of Teacher-Small Group StudentsG in
More information(2)-14(김병수).fm
Res. Plant Dis. 16(2) : 141-147 (2010) Research in Plant Disease The Korean Society of Plant Pathology ü q š t w ½ *Á«k 1,2 Áy 1 Á Á Á xá½x w w, 1» š x, 2 x» t» x Resistance to Phytophthora Blight of Commercial
More information50(6)-03.fm
Journal of the Korean Chemical Society Printed in the Republic of Korea w yw w w ½ Á Áw Á k * w yw w w w w w (2006. 8. 9 ) Relationship between Conceptual Understanding and Mapping Errors Induced in Learning
More information(조인숙)-o.fm
식물병연구 Res. Plant Dis. 19(4) : 326 330 (2013) http://dx.doi.org/10.5423/rpd.2013.19.4.326 Note Open Access Research in Plant Disease The Korean Society of Plant Pathology 국내양앵두나무에서발생한 Cherry green ring
More informationDBPIA-NURIMEDIA
Printed in the Republic of Korea "/"-:5*$"- 4$*&/$& 5&$)/0-0(: Vol. 18, No. 5, 436-443, 2005,1"$ w Q) t p z Á 1w w œw 2 w œ yw Effects of surface properties and solution ph on the pollutants removal of
More information8(3)-01.fm
w» wz, 8«3y(2006) Korean Journal of Agricultural and Forest Meteorology, Vol. 8, No. 3, (2006), pp. 125~131 2003 û šþ vw k y³á Á ûxáû «Á½» Á½ Á½ š w yû (2006 3 7 ; 2006 6 17 ) A Survey on Low Temperature
More information( )Kju225.hwp
비임균성비뇨생식기감염에서 의진단적효용성 Usefulness of the Mycofast Test (MYCOFAST Evolution 2) for the Diagnosis of Nongonococcal Genitourinary Infections Hang Ro Park, Yang Hyun Kim, Ho Jae Lee, Jea Sang Oh, Hyoung Jin
More information16(5)-06(58).fm
Journal of Korean Powder Metallurgy Institute DOI: 10.4150/KPMI.2009.16.5.336 y-y w Sm-Fe w ƒ w zá *Á w»» The Effect of Excess Samarium Oxide on the PreparationG of Sm-Fe Alloy Powder by Reduction-diffusion
More information51(2)-09.fm
2007, Vol. 51, No. 2 Printed in the Republic of Korea xw yw w w» e w z Á Á y Áw # Á k * w yw w w w w w # w w w (2006. 10. 30 ) Influences of Current Education Programs for Preservice Chemistry Teachers
More informationfm
w sw x w w w x y w w sw J[FTQRJ[VG w 5CVQƒw e UWDOGTIGF J[FTQRJ[VG šw z w w w w ù p w s w r w z w w kw p ³ w š w z w š w w kw mƒ w š w s w q 8CNNKUPGTKC FGPUGUGTTWNCVC½ ½ Õ 6[RJC NCZKOCPPK -KO CPF %JQK
More information, 66~67dB»e 55dB š 12dBù û»e(65db) w 70~71dB ñ. ù ü»» 35dB(ü), 45dB() r. w» w 1938 œk ³Ø w, 1960 Ø, 1968 ³Ø w. w 1972 ³Ø w w ³ ƒwš, ù y Ø w ³w
ª Œª Œ 26ƒ 1D Á 2006 1œ pp. 1~11 ª qp md w An Analysis of the Traffic Noise Measurement Plans of Apartment Complexes A Case on the North Riverside Expressway in Seoul Á Kang, Jun MoÁLee, Sung Kyung Abstract
More information15.fm
Journal of the Korean Ceramic Society Vol. 44, No. 2, pp. 98~102, 2007. Effect of Recycling Time on Stability of Colloidal Silica Slurry and Removal Rate in Silicon Wafer Polishing Eun-Suck Choi and So-Ik
More information4.fm
Journal of the Korean Ceramic Society Vol. 46, No. 1, pp. 30~34, 2009. Optimization of Glass Wafer Dicing Process using Sand Blast Won Seo, Young-mo Koo*, Jae-Woong Ko**, and Gusung Kim Department of Electronic
More information김범수
Analysis of Outcomes after Resection of Sarcomatous Hepatocellular Carcinoma Purpose: Sarcomatous hepatocellular carcinoma (HCC) is rare. Therefore, the clinicopathologic characteristics and prognosis
More information07.051~058(345).fm
w wz 8«3y 2008 6 pp. 51 ~ 58 m qp yp š w k sƒ Evaluation of Dynamic Modulus based on Aged Asphalt Binder y*á **Á***Á**** Lee, Kwan-HoÁCho, Kyung-RaeÁLee, Byung-SikÁSong, Yong-Seon Abstract Development
More information패션 전문가 293명 대상 앙케트+전문기자단 선정 2010.1 Fashionbiz CEO Managing Director Creative Director Independent Designer
READY-TO-WEAR Fashionbiz 2010.1 패션 전문가 293명 대상 앙케트+전문기자단 선정 2010.1 Fashionbiz CEO Managing Director Creative Director Independent Designer READY-TO-WEAR Fashionbiz 2010.1 1 2 3 4 5 6 7 8 9 9 2010.1 Fashionbiz
More informationDBPIA-NURIMEDIA
한국소음진동공학회 2015추계학술대회논문집년 Study of Noise Pattern and Psycho-acoustics Characteristic of Household Refrigerator * * ** ** Kyung-Soo Kong, Dae-Sik Shin, Weui-Bong Jeong, Tae-Hoon Kim and Se-Jin Ahn Key Words
More information03-서연옥.hwp
농업생명과학연구 49(4) pp.31-37 Journal of Agriculture & Life Science 49(4) pp.31-37 Print ISSN 1598-5504 Online ISSN 2383-8272 http://dx.doi.org/10.14397/jals.2015.49.4.31 국가산림자원조사 자료를 적용한 충남지역 사유림경영율 추정 서연옥
More information14(4)-14(심고문2).fm
w» wz, 14«4y(2012) (ISSN 1229-5671) Korean Journal of Agricultural and Forest Meteorology, Vol. 14, No. 4, (2012), pp. 260~264 DOI: 10.5532/KJAFM.2012.14.4.260 Author(s) 2012. CC Attribution 3.0 License.
More informationMicrosoft Word - pv_0602.doc
1 씨감자 생산 체계와 바이러스병 검사 (화란체계를 중심으로) 함 영 일 대관령원예농협 기술자문위원 To whom correspondence should be addressed. E-mail :yih0512430@yahoo.co.kr 목 차 1. 서언 2. 화란 씨감자 생산단계와 검사 2.1. 보증된 씨감자의 중요성 2.1.1. 최소한의 질적 요구조건 2.1.2.
More information201.fm
Jour. Korean Earth Science Society, v. 31, no. 2, p. 119 128, April 2010 (w ) w x 1, *Á 2 1w Ÿ, 305-350, Ÿ w 92 2 w w œw, 402-751, Ÿ û x 253 A Comparative Analysis of Linearity and Range of Gravity and
More information18103.fm
J. of the Korean Sensors Society Vol. 18, No. 1 (009) pp. 8 3 VO w PCM yá Á Á Ÿ Built-in protection circuit module by using VO temperature sensors K. H. Song, J. B. Choi, M. W. Son, and K. S. Yoo Abstract
More information8(3)-15(p ).fm
w wz J. Kor. Soc. Cloth. Ind. 8«3y, 2006 Vol. 8, No. 3, pp.357-362(2006) w p k sƒ ½ Á Á w w w A Study on the Mechanical and Hand Properties of the Lining Fabrics Myung-Ok Kim, Mi-Kyung Uh and Myung-Ja
More information012임수진
Received : 2012. 11. 27 Reviewed : 2012. 12. 10 Accepted : 2012. 12. 12 A Clinical Study on Effect of Electro-acupuncture Treatment for Low Back Pain and Radicular Pain in Patients Diagnosed with Lumbar
More information18211.fm
J. of the Korean Sensors Society Vol. 18, No. 2 (2009) pp. 168 172 p k ù p p l xá xá ³ Á *Á w * Fabrication of the CNT-FET biosensors with a double-gate structure Byunghyun Cho, Byounghyun Lim, Jang-Kyoo
More information( )-123.fm
Journal of the Korean Ceramic Society Vol. 48, No. 1, pp. 63~68, 2011. DOI:10.4191/KCERS.2011.48.1.063 Effects of Substituting B 2 O 3 for P 2 O 5 on the Structure and Properties of SnO-P 2 O 5 Glass Systems
More information82-02.fm
w y wz 8«( 2y) 00~00, 2005 J. of the Korean Society for Environmental Analysis Calix[6]arene w k š w *Á x Á Á«ƒm w yw, *w w yw Cesium Ion Selective Solid Contact Electrodes Based on Calix[6]arene Won-sik
More information