Res. Plant Dis. 15(3) : 254-258 (2009) Research in Plant Disease The Korean Society of Plant Pathology t (Lagenaria leucantha var. gourda) w IB m Cucumber mosaic virus Áy 1 Á»x 1 Á t 2 Á * w w, 1 w y w, 2 w w A Subgroup IB Isolate of Cucumber mosaic virus Isolated from Lagenaria leucantha var. gourda Sun Mi Oh, Jin Sung Hong 1, Ki Hyun Ryu 1, Gung Pyo Lee 2 and Jang Kyung Choi* Department of Applied Biology, Kangwon National University, Chuncheon 200-701, Korea 1 Division of Environment & Life Sciences, Seoul Women's University, Seoul 139-774, Korea 2 Division of Applied Plant Sciences, Chungang University, Ansung 456-756, Korea (Received on November 17, 2009; Accepted on December 7, 2009) An isolate of Cucumber mosaic virus (CMV), called as Lag-CMV, was identified from Lagenaria leucantha var. gourda showing mosaic symptom, and its properties was compared to Fny-CMV (subgroup IA) and As- CMV (subgroup IB) by host reaction in several indicator plants, dsrna analysis, RT-PCR analysis, restriction enzyme profile of the PCR products and nucleotide sequence of coat protein gene. Lag-CMV was similar to As-CMV used as a control CMV by the induced chlorotic spot on inoculated leaves and mosaic symptoms on upper leaves of N. tabacum. cv. Xanthi nc. In the cucumber and zucchini squash, Lag-CMV and As-CMV induced a mild mosaic symptoms than that of Fny-CMV. Size and shapes of local lesions on Chenophodium amaranticolor and Vigna unguiculata induced by Lag-CMV was similar those by Fny-CMV or As-CMV. In experiments of dsrna profiles and RT-PCR analysis of coat protein gene, Lag-CMV was come within subgroup I CMV. Moreover, restriction enzyme analysis using EcoRI, SalI, MspI, XhoI, and HindIII of the RT- PCR products and nucleotide sequence analysis of the coat protein gene showed that Lag-CMV belong to a member of CMV subgroup IB of the same to As-CMV. Keywords : Cucumber mosaic virus, Lagenaria leucantha var. gourda., Host reaction, Restriction enzyme profile, Subgroup IB Bromoviridae Cucumovirus w Cucumber mosaic virus(cmv), swš» ƒ vw š, ù y{ ƒ w š (Tomlinson, 1987). CMV RNA1, RNA2 RNA3 3 (+) ƒ RNA RNA3 3' w w RNA(RNA4) swwš (Palukaitis, 1992). ¾ š m CMV j I II š (Owen Palukaitis, 1988),» *Corresponding author Phone) +82-33-250-6432, Fax) +82-33-241-1721 Email) jkchoi@kangwon.ac.kr p x w (Kaper Waterworth, 1981), v rp ELISA(enzyme-linked immunosorbent assay) (Edwards Gonsalves, 1983), RNase protection w heterogenecity (Owen Palukaitis, 1988) RT-PCR(reverse transcription-polymerase chain reaction) w v wz (Rizos, 1992) w š. I w RNA3 5'» p k IA IB wš (Roossinck, 1999). t (Lagenaria leucantha var. gourda) (Lagenaria leucantha) w y. x
t (Lagenaria leucantha var. gourda) w IB m Cucumber mosaic virus 255 (KI /QUCKE U[ORVQOU KP PCVWTCNN[ KPHGEVGF.CIGPCTKC NGWECPVJCXCTIQWTFC wš w š. ¾ t š ù, l Cucumber mosaic virus(cmv) (Choi, 1999), Cucumber green mottle mosaic virus(cgmmv) (Lee, 1990; Kim Lee, 2000; Antignus, 2001), Zucchini yellow mosaic virus(zymv) (Lisa, 1981), Zucchini green mottle mosaic virus(zgmmv) (Ryu, 2000; Lee, 2003) y. 1999 8, w s x j t (Fig. 1) w g l CMV w m wš, ¾ t CMV m w p w. ¾. j t 0.01 M (ph 7.0) w z, 5-6» Nicotiana benthamiana w. 10 z N. benthamiana w t Cucumovirus p v (CPT-all primer) (Choi, 1999) w RT-PCR(reverse transcription-polymerase chain reaction)) w, 950 bp j» cdnaƒ. t j CMV w m w š Chenopodium amaranticolor w w. mw N. benthamiana C. amaranticolor w x 2z w, x 5-6» N. benthamiana w œ w š, t w CMV Lag- CMV w. wr CMV ¾ Fny-CMV( IA) As-CMV( IB) œ w. t. Lag-CMV» p w» w CMV p š N. tabacum cv. Xanthi nc, N, glutinosa, Cucubita pepo cv. Black beauty, Cucumis sativus cv. Suyo, Vigna unguiculata cv. Kurotanesanzaku Capsicum annuum cv. Cheongyang œ w. e 0.01 M w w, w t 25 o C-30 C 2 o š ùkù Fny-CMV As- CMV w t wì w. Lag-CMV Fny-CMV As-CMV» ùkù p Table 1 6CDNG4GCEVKQPQHKPFKECVQTRNCPVUD[OGEJCPKECNKPQEWNCVKQP QH.CI(P[CPF#U *QUVRNCPV.CI 5[ORVQOU C (P[ #U 0KEQVKCPCDGPVJCOKCPC / / / 0INWVKPQUC / / / 0VCDCEWOEX:CPVJKPE %5/ / %5/ %JGPQRQFKWOCOCTCPVKEQNQT... %CRUKEWOCPPWWOEX%JGQPI[CPI / O/ %WEWDKVCRGRQEX$NCEMDGCWV[ / %5/ / %WEWOKUUCVKXWUEX5W[Q / / / 8KIPCWPIWKEWNCVC... a Inoculated leaves/upper leaves, M: mosaic, mm: mild mosaic, CS: chlorotic spot, L: necrotic local lesion, -: symptom less or not infected. (KI5[ORVQOUQPKPFKECVQTRNCPVUD[OGEJCPKECNKPQEWNCVKQP QH.CI KUQNCVGF HTQO.CIGPCTKC NGWECPVJC XCT IQWTFC (P[ CPF #U YGTG KPQEWNCVGF CU C EQPVTQN U 2JQVQITCRJU CTG RTGUGPVGF QP KPQEWNCVGF NGCXGU QH 0KEQVKCPC VCDCEWOEX:CPVJKPECPFQPWRRGTNGCXGUQH%WEWOKUUCVKXWU EX 5W[Q %WEWTDKVC RGRQ EX $NCEM DGCWV[ CPF %CRUKEWO CPPWWOEX%JGQPI[CPITGURGEVKXGN[
256 Áy Á»xÁ tá w. t w Lag-CMV N. benthamiana x j ùkü œ w CMV w. ù N. tabacum. cv. Xanthi nc n x As-CMV w, ùkü Fny- CMV (Fig. 2). wr Fny-CMV j y w j ùkü, Lag-CMV As-CMV j x. š Fny-CMV As-CMVƒ 7~10 z j x ù, Lag-CMV y. ù Lag-CMV w š w Cucumovirus p v w RT-PCR w, cdnaƒ Lag-CMV š ƒ. wr C. amaranticolor V. unguiculata 2-3 z x CMV. DsRNA. Lag-CMV RNA j»» w Lag-CMV, Fny-CMV As-CMV N. benthamiana l Morris Dodds (1979) ƒ RNA(double stranded RNA; dsrna) w. w dsrna 6% polyacrylamide gel 1 TAE (40 mm Tris, 40 mm acetic acid, 2 mm EDTA, ph 7.8)» w z, ethidium bromide w w. Lag- CMV N. benthamiana l w dsrna» ql Fny-CMVù As-CMV dsrna j» ùkü (Fig. 3). dsrna wù CMV ƒ š, RNA satellite RNA w w (Dodds, 1993). w Wang (1988) m CMV l w dsrna», dsrna ƒ m x x(serotype) ew š šw. w š l w, Lag-CMV dsrna Fny-CMVù As-CMV x x q. RT-PCR wz. Lag-CMV N. benthamiana w total RNA wš, w RT-PCR w. Total RNA Choi (1998) w, RT-PCR v IR 3' sww Cucumovirus p v (Choi, 1999) w (KI 2QN[CET[NCOKFG IGN GNGEVTQRJQTGUKU QH FU40# KUQNCVGF HTQO0KEQVKCPCDGPVJCOKCPCKPHGEVGFYKVJ.CI#U CPF(P[TGURGEVKXGN[#NKSWQVQHFU40#RWTKHKGFD[%( EGNNWNQUGYCUGNGEVTQRJQTGUGFKPRQN[CET[NCOKFGIGN.» PCR 1.2% agarose gel 1 TAE» w, 3 CMV l 950 bp cdnaƒ (Fig. 4A). cdna wz EcoRI HindIII, MspI, SalI XhoI w z, wz ql(rflp) w Lag-CMV w. Lag-CMV RFLPql œ w 5 wz As-CMV ew Lag-CMVƒ IB (Fig. 4B). Singh (1995) CMV m w v cdna w EcoRI MspI w, I II w w š w. ù z w IA IB w. x HindIII IA IB CMV w» w wz ƒ. v p. Lag-CMV v w» w» w, CMV RNA3 v sww 950 bp cdna w. Lag-CMV CMV N. benthamiana l w total RNA x RT-PCR wwš, 1.2% agarose gel» w, ƒ CMV cdna w. w ƒ cdna pgem-t easy vector (Promega) ligation k z E. coli JM109 j w, GFX Micro Plasmid Prep kit (Amersham Parmacia) w w v w. w v wz EcoRI w y w, y v w» w. v» MacAlign(DNAstar 3.30C) w
t (Lagenaria leucantha var. gourda) w IB m Cucumber mosaic virus 257 (KI4GXGTUGVTCPUETKRVKQPRQN[OGTCUGEJCKPTGCEVKQP462%4CUUC[#CPFTGUVTKEVKQPGP\[OGCPCN[UKUQHVJGRTQFWEVU$HQTVJG JCNHTGIKQPQH40#EQXGTKPIHWNNNGPIVJEQCVRTQVGKPIGPGHTQO.CI#UCPF(P[TGURGEVKXGN[&KIGUVGFTGUVTKEVKQP HTCIOGPVUYGTGUGRCTCVGFQPCCITQUGIGNCPFUVCKPGFYKVJGVJKFKWODTQOKFG.CPG/MD&0#NCFFGTNCPG'EQ4+NCPG *KPF+++NCPG/UR+NCPG5CN+CPFNCPG:JQ+TGURGEVKXGN[ (KI%QORCTKUQPQHCOKPQCEKFUGSWGPEGQHEQCVRTQVGKPDGVYGGP.CI#UCPF(P[+FGPVKECNTGUKFWGUCTGKPFKECVGF D[J[RJGP w z ƒ w (Fig. 5).» Lag-CMV As-CMVƒ 99.1%, Lag-CMV Fny-CMV 94.5%,» w w Lag-CMV As-CMV 100%, Lag-CMV Fny-CMV 97.3%. Lag-CMV As- CMV 218 ew, Fny- CMV v 5 (25, 65, 71, 99, 205 ) ey ùkþ. t w Lag-CMV v As-CMV ew IB w CMV y. x j t (Lagenaria leucantha var. gourda) l CMV wš Lag-CMV w. t w Lag-CMV N. benthamiana x j ùkü œ w CMV w. ù N. tabacum. cv. Xanthi nc n x As-CMV w, ùkü Fny- CMV. w Fny-CMV j y w j ùkü, Lag-CMV As-CMV j x. š Fny-CMV As-CMV ƒ j x ù, Lag-CMV. Lag-CMV N. benthamiana l w dsrna» ql Fny- CMVù As-CMV dsrna j» ùkü. Lag-CMV N. benthamiana l w total RNA v IR 3' sww 950 bp cdnaw w v w RT-PCR w 950 bp cdnaƒ. cdna wz EcoRI, HindIII, MspI, SalI XhoI w z RFLP w, Lag-CMV RFLPql As-CMV ew. wr cdna w» w,» As-CMV 99.1%, Fny- CMV 94.5%, v As-CMV 100%, Fny-CMV 97.3% ùkþ. l t w Lag- CMV As-CMV IB w y.
258 Áy Á»xÁ tá 2009 21 ( y: 20080401034055) w,. š x Antignus, Y., Wang, Y., Perlsman, M., Lachman, O., Lavi, N. and Gal-On, A. 2001. Biological and molecular characterization of a new cucurbit-infecting Tobamovirus. Phtopathoiogy 91: 565-571. Choi, J. K., Kim, H. J., Hong, J. S., Kim, D. W. and Lee, S. Y. 1998. Identification and differentiation of cucumber mosaic virus isolates in Korea. Korean J. Plant Pathol. 14: 7-12. Choi, S. K., Choi, J. K., Park, W. M. and Ryu, K. H. 1999. RT- PCR detection and identification of three species of cucumoviruses with a genus-specific single pair of primers. J. Virol. Methods 83: 67-73. Dodds, J. A. 1993. DsRNA in diagnosis. In : Diagnosis of Plant Virus Diseases, ed. by R.E.F. Matthews. pp. 273-295. CRC Press, Boca Raton, USA. Edwards, M. C. and Gonsalves, D. 1983. Grouping of seven biologically defined isolates of cucumber mosaic virus by peptide mapping. Phytopathology 73: 1117-1120. Kim, D. H. and Lee, J. M. 2000. Seed treatment for Cucumber green mottle mosaic virus (CGMMV) in gourd (Lagenaria siceraria) seeds and its detection. J. Kor. Soc. Hort. Sci. 44: 1-6. Kaper, J. M. and Waterworth, H. E. 1981. Cucumoviruses. In : Handbook of Plant Virus Infections, ed. by E. Kurstak, pp. 257-332. Elsevier/Holland Biolmedical, New York, USA. Lee, G. P., Min, B.E., Kim, C. S., Choi, S. H., Ham, C. H., Kim, S. U. and Ryu, K. H. 2003. Plant virus cdna chip hybridization for detection and differentiation of four cucubit-infecting tobamovirus. J. Virol. Methods 110: 19-24. Lee, K. W., Lee, B. C., Park, H. C. and Lee, Y. S. 1990. Occurrence of cucumber green mottle mosaic virus disease of watermelon in Korea. Korean J. Plant Pathol. 6: 250-255. Lisa, V., Boccardo, G., Dgostino, G. and Dellavlle, G. 1981. Characterization of a potyvirus causing zucchini yeiiow mosaic virus. Phytopathology 71: 667-672. Morris, T. J. and Dodds, J. A. 1979. Isolation and analysis of double-stranded RNA from virus-infected plant and fungal tissue. Phytopathology 69: 854-858. Owen, J. and Palukaitis, P. 1988. Characterization of cucumber mosaic virus. I. Molecular heterogenecity mapping of RNA3 in eight CMV strains. Virology 166: 496-502. Palukaitis, P., Roossinck, M. J., Dietzgen, R. G. and Francki, R. I. B. 1992. Cucumber mosaic virus. Adv. Virus. Res. 41: 281-348. Rizos, H., Gunn, L. V., Pares, R. D. and Gillings, M. R. 1992. Differentiation of cucumber mosaic virus isolates using the polymerase chain reaction. J. Gen. Virol. 73: 2009-2103. Roossinck, M. J., Zhang, L. and Hellwald, K. H. 1999. Rearrangement in the 5' nontranslated region and phylogenetic analysis of cucumber mosaic virus RNA3 indicated radial evolution of three subgroups. J. Virol. 73: 6752-6758. Ryu, K. H., Min, B. E., Choi, G. S., Choi, S. H., Kwon, S. B., Noh, G. M., Yoon, J. Y., Choi, Y. M., Jang, S. H., Lee, G. P., Cho, K. H. and Park, W. M. 2000. Zucchini green mottle mosaic virus is a new Tabamovirus; Comparison of its coat protein gene with that of Kyuri green mottle mosaic virus. Arch. Virol. 145: 2325-2333. Singh, Z., Jones, R. A. C. and Jones, M. G. K. 1995. Identification of Cucumber mosaic virus subgroup I isolates from banana plants affected by infectious chlorosis disease using RT-PCR. Plant Dis. 79: 713-716. Tomlinson, J. A. 1987. Epidemiology and control of virus diseases of vegetables. Ann. Appl. Biol. 110: 661-681. Wang, W. Q., Natsuaki, T., Okuda, S. and Teranaka, M. 1988. Comparison of cucumber mosaic virus isolate by duoblestrand RNA analysis. Ann Phytopath. Soc. Japan 54: 536-539.